KEGG   Corynebacterium falsenii: CFAL_05605Help
Entry
CFAL_05605        CDS       T03037                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cfn  Corynebacterium falsenii
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cfn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CFAL_05605
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFAL_05605
  Energy metabolism
   00680 Methane metabolism
    CFAL_05605
Enzymes [BR:cfn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CFAL_05605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(1287215..1289971)
Genome map
AA seq 918 aa AA seqDB search
MRDDTRYLGTILGDVIREQEGEYTFNLIENARAAAFDLRYGELRVADLAEQIKAVPTDKA
LPVIRAFSHFALMANLAEDLHAERLREKAADEGEAAQPSTLEYTWKALDDNGVSAEAVAA
TMEKAMVAPVLTAHPTETRRRTVFDVQKDIMKMMRRRGEILNAPNNARTQQRLEAIDLVI
RRRMTLLWQTALIRSVRPRIEDEIKVGLRYYGISLLTEIPAINRRVNEHMCQRYGDAVKR
TPMVRPGSWIGGDHDGNPFVTAETVELATSSAARTIFEYYVDTLYYLEHELSLSSRLTEV
TDELADLADRGHNDIPSRADEPYRRALHGMRGRVAATAKQSLGEPVVAGGVHKGHKPYTG
PEELLADIHVVDASLRNSMDELLADHTLADLREAVETFGFHLSALDLRQNSESFEEVLTE
IFAHAAVHDDYAQLDEDAKIELLLRELQSPRPLVDPEAEFSDNTAKELGIFRAAAAAARK
FGPQVIPHCIISMAESVSDILEPMILLKEVGLIRAHRDAPTGSVDVIPLFETIDDLAGGA
EIMRKLWKLPLYRNYVQQRGDRQEIMLGYSDSNKDGGYFAANWALYDAELALVSAASDAD
ISLRLFHGRGGTVGRGGGPSYEAILAQPEGAVQGAVRITEQGEIISAKYGDRVNARHNLE
ALVAATLEASLLPVDEIENPEPAYETMRELSALSQKAYAALMHEDPGFIQYFTSSTPLHE
IGSLNIGSRPSSRKETKNISDLRAIPWVLSWSQSRIMLPGWFGVGSALEQWLADGQSISG
SEKERLNYLRELHKRWPFFDSVLSNMAQVMSKADMAIAELYSHLVPDQDDAKRIFSIIEK
EYRLTVEMYLKITGRESLLTDNPELANSVRNRFPYLVPLNLLQVELLRRYRAGDDSRKVR
SGIQLTMNGLATALRNSG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgacgacacgcgctacctcggcaccatcctgggcgacgtcatccgcgaacaggaa
ggtgagtacacgttcaacctcatcgagaacgcgcgtgcggcggccttcgacctgcgttac
ggtgagctgcgcgtcgccgacctcgccgagcagatcaaggccgtgccgacggataaggcg
ctgcccgtaattcgcgcgttctcgcacttcgccctcatggcgaacctggccgaggacctc
cacgcggaacggctgcgcgaaaaggcggccgacgagggcgaggccgcgcagccctcgacc
ctcgagtacacgtggaaggccctggatgacaacggcgtttcggccgaggccgtggcggcg
acgatggaaaaagccatggtcgcgcccgtgctcaccgcgcaccccaccgaaacgcggcga
aggaccgtcttcgacgtgcagaaggacatcatgaagatgatgcgccgacgcggggagatc
ctcaacgcccccaacaacgctcgcacacagcagcgactcgaagccattgacctcgttatt
cgacgccgcatgacgctgctctggcagacggcactgatccgtagcgtgcgaccccgcatc
gaggatgaaatcaaggtgggcctgcgctactacggcatcagcctgctcaccgagatcccg
gcgatcaaccggcgtgtgaatgagcacatgtgccaacgctacggcgacgcagtaaagcgc
accccgatggtgcgccctggatcgtggatcggcggcgaccacgacggcaatccgttcgtc
accgcggagacggtggagctggccacgagttccgcggcgcggacgatcttcgagtactac
gtggacacgctgtattacctcgagcacgagctgagcttgtcctcgcggctgacggaagtc
accgatgagctcgccgacctggcagatcgcgggcacaacgacattccctcgcgggctgac
gaaccgtaccgacgggcgctgcacggaatgcgcggacgggtggcggccacggcgaagcag
tcgctgggggagccggtcgtggccggtggtgtgcacaaggggcacaagccgtacaccggt
cccgaggagttgctggccgacattcacgtggtcgatgcctcgctgcgcaactccatggac
gagctgttggccgaccacaccctggcggacctccgcgaggccgtggagacctttgggttc
cacctctcggcgctggatctgcgccagaactccgagagcttcgaggaggtcctcacggag
attttcgcgcacgccgccgtgcacgatgattacgcacagctggacgaggacgccaagatc
gagctgttgctccgcgaactgcagagcccccgtccgctcgttgatccagaggcggagttc
agcgataacacggctaaggagctcggcatcttccgagccgctgctgccgcagcgcggaag
tttggcccgcaggtgatcccgcactgcatcatctccatggcggaatccgtctccgacatc
ctagagcccatgattctgctcaaggaggtgggactcattcgggcgcaccgggatgccccc
accggctcggtggatgtcatccccttgttcgagaccatcgacgacctcgccggtggtgct
gagatcatgcgcaagctctggaagctgccgctgtaccgcaactacgtgcagcagcgcggg
gaccggcaggagatcatgctgggatactcggactccaacaaggacggcgggtacttcgcg
gccaactgggcactgtatgacgccgagctggcgttggtgtccgccgccagcgatgcggac
atctcgctgcgcctgttccacggccgtggtggcacggtgggtcgcggtggcggcccgtcc
tacgaggcgatcctcgcccagcccgagggcgcggtgcagggcgccgtgcgcatcacggag
cagggcgagatcatctccgcgaagtacggcgaccgggtcaatgcccggcacaatctcgag
gcgctggtagcggccacgttggaagccagcctgttgcccgtcgacgagatcgagaatccg
gaaccggcttacgagacgatgcgggagctctccgcgctgtcgcagaaagcctacgctgcg
ctcatgcacgaggaccccggattcatccagtacttcacgtcctccacgccgctgcacgag
atcgggagcctcaacatcggctcgcgtccgtcctcgcgcaaggagacgaagaacatctcc
gatctccgcgctatcccgtgggtgctgagctggtcgcaatcgcgcatcatgctgcccggt
tggttcggcgtgggctcagctctggagcagtggttggccgatggccagtcgatctcgggg
agcgagaaagaacgcctgaactaccttcgcgaattgcacaagcgttggccgttcttcgac
tccgtgctgtccaacatggcgcaggtgatgtcaaaggcggacatggccattgcggagcta
tacagccacttggtgccggatcaggacgacgccaagcgtatcttctccatcatcgagaag
gaataccggctcaccgtggagatgtacctcaagatcaccggccgcgaatcgctgctgacg
gataacccagagctcgccaattcggtgcgcaaccggttcccatatctggttccgctcaac
ctgttgcaggtggagctgctgcgccgctaccgcgccggcgacgattctcggaaggtgcga
tccggaatccagttgacgatgaacggtctggccacggcactgcgcaactctggctag

DBGET integrated database retrieval system