KEGG   Corynebacterium falsenii: CFAL_10680Help
Entry
CFAL_10680        CDS       T03037                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cfn  Corynebacterium falsenii
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CFAL_10680
   00650 Butanoate metabolism
    CFAL_10680
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFAL_10680
   00280 Valine, leucine and isoleucine degradation
    CFAL_10680
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFAL_10680
Enzymes [BR:cfn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CFAL_10680
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CFAL_10680
Amino acid related enzymes [BR:cfn01007]
 Aminotransferase (transaminase)
  Class III
   CFAL_10680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2424504..2425832)
Genome map
AA seq 442 aa AA seqDB search
MEPRDYRIEQSRSITTELPGPKSAELKERCERAVSAAVNPGLPGYVVDADGGIIVDEDGN
RWIDFGSGIAVTSVGASHPAVVKAVQDAVSHFTHTCFMVSPYESYVKVAEILNHITPGDF
DKKTVLLNSGAEAVENAVKIARAYTKRNGVVVFDNAYHGRTNLTMAMTAKNKPYKTGFGP
FASEVYRAPMSYPARDGLSGEEAAQRTIRMMEKEVGAQNLACVVIEPIQGEGGFIVPAEG
FLPTIAQWCKDNGVVFVADEVQAGLCRTGKWFSVEWFDVVPDLITTAKGIAGGMPLSAVT
GRAEIMDAPVSGGLGGTYGGNPVAASAAVAALGVMRDEKLADRALEIEKIIREVLEPLTD
SGRVLEVRGHGAMIALEFVDANGKPDAQLTADVAGACKAKGVQILTCGMDANVIRLLPPL
VIGEDTLRDGLQVLAEEIRSRV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggaaccccgcgactaccgcattgaacagtcccgcagcatcactaccgaactgcccggc
cccaagagcgctgaactgaaggagcgctgcgagcgcgccgtctccgcagccgtcaacccg
ggcctgcccggttacgtcgtcgatgccgatggcggcatcatcgtcgatgaagacggcaac
cgctggatcgacttcggctccggcatcgccgtgaccagcgtcggcgcatcccacccggcc
gtcgtcaaggccgtgcaggatgccgtatcccacttcacccacacttgcttcatggtttcg
ccctacgagagctacgtgaaggtcgccgagatcctcaaccacatcacccccggcgacttc
gacaaaaagaccgtgctgctcaactccggcgccgaggccgtggaaaacgcggtgaagatc
gcccgcgcctacaccaagcgcaacggcgtggtggtcttcgacaacgcctaccacggccgc
accaacctcaccatggccatgaccgctaagaacaagccgtacaagaccggcttcggccca
ttcgcctccgaggtctaccgcgccccgatgtcctaccctgcccgcgatggcctctccggc
gaagaagccgcacagcgcaccatccgcatgatggaaaaggaagtcggtgcccagaacctc
gcctgcgttgtcatcgagccgatccagggcgaaggcggctttatcgttcccgccgagggc
ttcctgcccaccatcgcccagtggtgcaaggacaatggcgtggtcttcgtcgccgacgag
gtccaggctggcctgtgccgcacgggcaagtggttctccgtggagtggttcgacgtggtc
ccggacctcatcaccaccgcgaagggcatcgctggcggcatgccgctatccgcagtcacg
ggtcgcgcggagatcatggacgcacccgtctccggcggcttgggcggtacctacggtggc
aacccggtggcggcctccgcagcggtggcggctttgggcgtcatgcgagacgaaaagctg
gccgatcgcgccttggagatcgaaaagatcatccgtgaagtcctcgagccgctcaccgat
tccggccgtgtgctggaggttcgcggccacggcgccatgatcgccctggagttcgtggat
gccaacggtaagccggatgcgcagctcaccgccgatgtcgcgggtgcctgcaaggccaag
ggcgtgcagatcctcacctgcggcatggacgccaacgtgatccgcctgctcccgccgctg
gtcatcggcgaggacactctgcgcgacggactgcaggtgctggccgaggagatccgctcc
cgcgtctag

DBGET integrated database retrieval system