KEGG   Camponotus floridanus (Florida carpenter ant): 105249255Help
Entry
105249255         CDS       T03919                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
cfo  Camponotus floridanus (Florida carpenter ant)
Brite
Enzymes [BR:cfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105249255
Peptidases [BR:cfo01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   105249255
Exosome [BR:cfo04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   105249255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 329 aa AA seqDB search
MMSSYLLLAVIVPFVIFEIWHTGMXVVFVTSSIVQWPLKVEFSDPKSVGLEGARNFYLHT
DQQVKIGLWQILPRSLLNNSIPATDEAYEAVLNNSTQPVFLYMHGNSGNRASSHRLELYK
LFQDLDYHVIAFDYRSYGDSDIVELSEEGVVTDSKYVFEWVMKKVNGSVPVFVWGHSLGT
GVSAHVLALLAAENIQPAALFLEAPFTNIADELIEHPFAQLFKHLPWFHWVVVEPFYKNN
LRFESDKHITKIECPIMILHAEDDGVIPISLAEKLYKTAIDSHGNNTDRIQMIKIDSSYG
LGHKYICRYKKLPSIIKTFVAKANQNQTE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcaagttatctactattagcagtgatagtaccattcgtcatctttgagatttgg
catacaggaatgtaagttgtatttgtaactagtagtatagtgcaatggccacttaaagtg
gagttttctgatccaaaatcggttggattggaaggtgctagaaatttttatttacatact
gatcaacaagttaaaataggtttatggcagatattaccacggtctttattaaataattcc
attcctgcaacagatgaagcttacgaagcagttttaaataattccacacaacctgtattc
ctatatatgcatggaaacagtggtaatagagcaagttcgcatagacttgagctttataag
ctttttcaagatttggattatcatgtcatagcttttgattatagaagttatggcgatagt
gatatagtggaactttctgaagaaggtgtagttacggatagcaaatatgtttttgaatgg
gttatgaaaaaagttaatggttcagttccagtttttgtttggggtcactctttaggaact
ggagtctctgcgcatgtattagctctactagcagctgaaaatatacaaccagctgcatta
tttctggaagcaccatttaccaacatagcggatgaattaatagaacatccatttgcacag
ttattcaagcatttaccatggttccattgggtggttgttgaaccattttacaagaacaat
ctaagatttgaatctgataaacatattactaaaattgagtgtcccattatgatattacat
gccgaagatgatggtgtaattccaatctccttggcagagaagctttataaaacagcaata
gatagtcatggaaataatacagatcgtattcaaatgataaaaatagattcatcctacgga
cttggacataagtatatctgtagatacaaaaaattacccagtataattaagacatttgtt
gctaaagcaaaccaaaatcagactgaataa

DBGET integrated database retrieval system