KEGG   Camelus ferus (Wild Bactrian camel): 102503674Help
Entry
102503674         CDS       T02979                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00562  Inositol phosphate metabolism
cfr04022  cGMP-PKG signaling pathway
cfr04072  Phospholipase D signaling pathway
cfr04151  PI3K-Akt signaling pathway
cfr04261  Adrenergic signaling in cardiomyocytes
cfr04371  Apelin signaling pathway
cfr04611  Platelet activation
cfr04725  Cholinergic synapse
cfr04921  Oxytocin signaling pathway
cfr05145  Toxoplasmosis
cfr05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102503674 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    102503674 (PIK3CG)
   04072 Phospholipase D signaling pathway
    102503674 (PIK3CG)
   04022 cGMP - PKG signaling pathway
    102503674 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    102503674 (PIK3CG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    102503674 (PIK3CG)
  Endocrine system
   04921 Oxytocin signaling pathway
    102503674 (PIK3CG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102503674 (PIK3CG)
  Nervous system
   04725 Cholinergic synapse
    102503674 (PIK3CG)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    102503674 (PIK3CG)
   05145 Toxoplasmosis
    102503674 (PIK3CG)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102503674 (PIK3CG)
Membrane trafficking [BR:cfr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102503674 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135 DUF3244
Motif
Other DBs
NCBI-GeneID: 102503674
NCBI-ProteinID: XP_006185381
Position
Un
AA seq 1102 aa AA seqDB search
MELENYEPPVVLREDNCRRRRRMKQRSTAASLSSMELIPIEFVLPTSQRNTKTPETALLH
VASHGNVEQMKAQVWLRALETSVAADFYHRLGPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKVLHRSPGQIHLVQRSTPSEETLAFQRQLNALIGYDVTDVSNVHDDELEFTRRRL
VTPRMAEVAGRDPKLYAMHPWVTSKPLPEYLLKKITNNCIFIIIHRSTTSQTIKVSADDT
PGTILHSFFTKMAKKKSLMDIPESQNEQDFVLRVCGRDEYLVGETPIKNFQWVRQCLKNG
EEIHLVLDTPPNPDLDQVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPILPRNADLTVYVEANIQYGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSGKASAETPSPESKGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQLSGKGEDHGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHRPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKDPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVQVIDMLQKVTIDIKSLSAEKYDVSSQVISQLKQKLENLQNLNLP
QSFRVPYDPGLKAGALVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKCPIDEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQDVCVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIDYIRDALTVGKSEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atggagctggagaactatgaaccgcccgtggtgctgagagaggacaactgccgcaggcgc
cggaggatgaagcagcgcagcacggcggccagcctgtcctccatggagctcatccccatc
gagttcgtgctgcccaccagccagcgcaacaccaagacccccgaaacggcgctgctgcac
gtggccagccacggcaatgtggagcagatgaaggcccaggtgtggctgcgcgcgctggag
accagcgtggccgccgacttctaccaccgcctcggccccgatcacttcctcctgctctac
cagaagaagggacagtggtacgagatctatgacaagtatcaggtggtgcagaccctggac
tgcctgcgctactggaaggtgctgcaccgcagccctgggcagatccatctcgtgcagcgg
agcacgccctcagaggagacgctggctttccagcgccagctcaacgccctgatcggctac
gatgtcaccgacgtcagcaacgtgcacgacgacgagctggagttcacgcgccgccgcctg
gtcaccccacgcatggccgaggtggccggccgggaccccaagctctacgccatgcacccc
tgggtgacatccaagcccctcccggagtacctgttgaagaagatcaccaacaactgcatc
ttcatcatcattcatcgcagtaccactagccagaccatcaaggtctcggcggatgacacc
ccaggcaccatcctccatagcttctttaccaagatggccaagaagaagtctctgatggat
atccccgaaagccagaatgaacaagactttgtgttgcgcgtctgtggccgggatgagtac
ctggtaggtgagacgcccatcaaaaacttccagtgggtgaggcagtgcctgaagaacggg
gaagagattcacctggtgctggacacgcctccgaacccagacctggaccaggtgcgtaag
gaagagtggccactggtggatgactgcacaggagtcaccggctaccatgagcagctgacc
atccatgggaaggaccacgagagcgtgttcaccgtgtccctgtgggactgcgaccgcaag
ttcagggtcaagatcagaggcattgacatccccatcctgccccggaatgctgacctcacc
gtttatgtggaggcaaacatccagtatgggcagcaagtcctttgccaaagaagaactagc
cccaaacccttcacggaggaggtgctctggaacgtgtggcttgagttcagtatcaagatc
aaagacttacccaaaggcgccctgctgaacctccaaatctactgcggcaaagctccagca
ctgtctggtaaggcctctgcggagacccccagtcctgagtccaaaggcaaagctcagctt
ctctactatgtgaacctgctgctaatagaccaccgcttcctcctgcgccatggggagtac
gtgctccacatgtggcagctctcggggaagggggaagaccatggaagcttcaatgctgac
aagctcacgtcggcaaccaacccggacaaggagaactcaatgtccatctccattcttcta
gacaattactgtcaccccatagccttgcctaaacatcggcccacccctgacccggaaggg
gatcgggtgcgagccgaaatgcccaatcagcttcggaaacaactggaggcaatcatagcc
actgatccacttaaccctctcacggcagaagacaaagaattgctctggcatttcagatat
gaaagccttaaggaccccaaagcatatcctaagctctttagctccgtgaaatggggacag
caagaaattgtagccaaaacataccaactgttagccagaagggaggtctgggatcaaagt
gctttggatgttggattaaccatgcaactcctggactgcaacttttcagatgaaaatgta
agagccattgcagttcagaaactggagagcttagaggacgacgacgttctacattacctg
cttcagctggtccaggctgtgaaatttgaaccataccatgacagcgccctggccaggttt
ctgctgaagcgtggcttaagaaacaaaagaattggtcacttcttgttttggttcttgaga
agtgagatcgcccagtccaggcactatcagcagaggtttgcagtgattctggaagcctat
ctaaggggctgtggcacggccatgctgcacgacttcacccaacaagtccaagtaattgac
atgttacagaaagtcaccattgatattaaatcactctctgcagaaaagtatgacgtcagt
tcccaagttatttcccaacttaagcaaaagcttgaaaacctccagaatttgaatctcccc
cagagcttccgagttccatatgatcctggactgaaagcaggagcactggtgattgaaaaa
tgtaaagtgatggcctccaagaaaaagcccttgtggcttgagtttaaatgtgctgaccct
acagctctatcaaacgaaacaattggaattatctttaaacacggtgatgatctgcgccaa
gacatgctgattttacagattctacgaatcatggagtccatttgggagactgagtctttg
gatctgtgcctcctgccgtatggatgcatctcaactggtgacaaaataggaatgatcgag
atcgtgaaagacgccacaacgatcgccaaaattcagcaaagcacggtgggcaacacgggc
gcctttaaagatgaagtcctgaatcactggctcaaggaaaaatgccccattgacgaaaag
tttcaggcagcggtggagagatttgtttattcctgcgctggctactgtgtggcaaccttt
gttcttggaataggcgacagacacaatgacaatattatgatctcagagacaggaaatcta
tttcacattgacttcgggcacattcttgggaattacaaaagtttcctgggcattaataaa
gaaagagtaccctttgtgctgaccccagacttcctgtttgtgatggggacttccggaaag
aagacaagcctacacttccagaaatttcaggacgtctgcgttaaggcttacctagccctt
cgtcatcacacaaacctgctgatcatcctgttctccatgatgctgatgactgggatgccc
cagctaaccagcaaagaagacattgactacattcgggatgccctcacagtggggaaaagt
gaggaggacgctaagaagtattttctggatcagattgaagtttgcagagacaaaggatgg
actgtgcagtttaactggttcctgcatcttgttcttggcatcaaacaaggagagaaacat
tccgcctaa

DBGET integrated database retrieval system