KEGG   Camelus ferus (Wild Bactrian camel): 102505509Help
Entry
102505509         CDS       T02979                                 

Gene name
CREBBP
Definition
CREB binding protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cAMP signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Long-term potentiation
Melanogenesis
Thyroid hormone signaling pathway
Huntington's disease
Tuberculosis
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Renal cell carcinoma
Prostate cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    102505509 (CREBBP)
   04330 Notch signaling pathway
    102505509 (CREBBP)
   04350 TGF-beta signaling pathway
    102505509 (CREBBP)
   04630 Jak-STAT signaling pathway
    102505509 (CREBBP)
   04066 HIF-1 signaling pathway
    102505509 (CREBBP)
   04068 FoxO signaling pathway
    102505509 (CREBBP)
   04024 cAMP signaling pathway
    102505509 (CREBBP)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102505509 (CREBBP)
  Cellular commiunity
   04520 Adherens junction
    102505509 (CREBBP)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102505509 (CREBBP)
   04916 Melanogenesis
    102505509 (CREBBP)
  Nervous system
   04720 Long-term potentiation
    102505509 (CREBBP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102505509 (CREBBP)
   05206 MicroRNAs in cancer
    102505509 (CREBBP)
   05203 Viral carcinogenesis
    102505509 (CREBBP)
   05211 Renal cell carcinoma
    102505509 (CREBBP)
   05215 Prostate cancer
    102505509 (CREBBP)
  Neurodegenerative diseases
   05016 Huntington's disease
    102505509 (CREBBP)
  Infectious diseases
   05152 Tuberculosis
    102505509 (CREBBP)
   05166 HTLV-I infection
    102505509 (CREBBP)
   05164 Influenza A
    102505509 (CREBBP)
   05161 Hepatitis B
    102505509 (CREBBP)
   05168 Herpes simplex infection
    102505509 (CREBBP)
   05169 Epstein-Barr virus infection
    102505509 (CREBBP)
Enzymes [BR:cfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102505509 (CREBBP)
Transcription factors [BR:cfr03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    102505509 (CREBBP)
Mitochondrial biogenesis [BR:cfr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102505509 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2345 aa AA seqDB search
MAGLGAMGKSPLNQGDSSAPTLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQT
GPGICMNANFNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAM
QGATSSVLAETLTQVSPQMTSHAGLNTAQAGGMTKMGMTGNTSPFGQPFNQTGGQQMGAP
GVNPQLPSKQSIVNSLPPFPADIKNASVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKR
KLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCAS
SRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLS
NPNPIDPSSMQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNI
PAGGITTDQQPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKG
WHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYY
HLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPAPGTQPPGIPQAQPVRPPNGPMSLP
VNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRSASPMNHSVPMNSMGSVPGMAISPSRMPQ
PPNMMGAHANNMMAQAPAQNQFLPQNQFPSSSGAMSVNSVGMGQPAAQAGVSQGQVPGAA
LPNPLNMLGPQASQLPCPPVTQSPLHQTPPPASTAAGMPSLQHPAAPGMTPPQPAAPTQP
STPVSSSGQTPTPTPGSVPSASQTQSTPTVQAAAQAQVTTQPQTPVQPPSVATPQSSQQQ
PTPVHAQPPGTPLSQAAASIDNRVPTPSSVASTETNSQQPGPDVPMLEMKAEVKTEDTEP
DASEPKGEPGSAMMEEDLQGSSQVKEETDPAEQKSEPMEVDEKKPEVKVEAKEEEESSAN
GTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDI
VKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQE
IDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGEN
VTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVC
DNCLKKTGRTRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKT
VEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRR
VYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHP
PDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNV
LEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKP
TMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFL
TLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDL
CINCYNTKSHTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNA
NCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKH
KLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPTSAPPGTPTQQPSTPQTPQ
PPAQPQPSPVSMSPAGFPNVARTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIER
EAQQQQHLYRVNINNGMPPGRTGMVTPVSQMAPVGLNVPRPNQVSGPVVPNLPPGQWQQA
PIPQQQPMPGMPRPVMSMQAQPAVAGPRMPSVQPPRSISPGALQDLLRTLKSPSSPQQQQ
QVLNILKSNPQLMAAFIKQRTAKYVASQPGLQPQPGLQAQPGLQPQPSLHQQPSLQNLNT
MQAGGPRPGVPPQQQAMGGLNPQGQALNIMNPGHNPSMASMNPQYREMLRRQLLQQQQQQ
QQQQQQQQQQQQQQQQQQPPGGAGMAGGMAGHSQFQQPQGPGGYPPAMQQQRMQQHLPIQ
GSSMGQMAAQMGQLGQMGQPGLGADSAPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQ
QHMLSGQPQASHLPGQQMATSLSSQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVS
PQTGSPHPGLAVTMASSIDQGHLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEK
FVEGL
NT seq 7038 nt NT seq  +upstreamnt  +downstreamnt
atggccggtctgggtgccatgggcaagagccctctgaaccagggagattcttcagcccct
accctgcctaaacaggcagccagcacctccgggcccactccccctgcttcccaagcactg
aatccgcaagcacaaaagcaagtggggctggtgaccagcagccctgccacgtcacagacg
ggacctgggatctgcatgaatgctaactttaaccagacccatccaggcctcctcaatagc
aactctggccatagtttgatgaaccaggcccagcaagggcaggcgcaagtcatgaatgga
tctcttggggctgctggcagaggaaggggagccggaatgccataccctgctccggccatg
cagggggccacgagcagcgtgctggccgagacattaacgcaggtttcgccgcaaatgacc
agtcatgcaggactgaacacagctcaggccggaggcatgaccaagatgggaatgactggt
aacacaagtccgtttggacaacccttcaatcaaactggagggcagcagatgggagcccct
ggagtgaaccctcagttacccagcaaacagagtatcgtcaatagcttgcctcccttccct
gcagacatcaagaatgcttccgtcaccaacgtgccaaacatgtctcagatgcaaacatct
gtgggaattgtacccacacaggcaattgcaacgggccccactgcagatcccgaaaagcgc
aaactgatacagcagcagctggttctactgcttcacgctcataaatgtcagaggcgggaa
caagccaatggagaggttcgggcctgctctctcccgcattgtcgaaccatgaaaaatgtt
ttgaatcacatgacacattgtcaggctgggaaagcctgtcaagttgcccattgtgcatct
tcacgacaaatcatctctcattggaagaactgcacacgacatgactgtcctgtttgcctc
cctttgaaaaatgccagtgacaagcgaaaccaacaaaccatcctggggtcgccagctagt
ggaattcaaaacacaattggttctgttggcacaggccaacagaatgccacttctttaagt
aacccaaatcccatagaccccagctccatgcaacgagcgtatgctgctcttggactcccc
tacctgaaccagcctcagacccagctgcagcctcaggttcctggccagcaaccagcacag
cctcaaactcaccagcagatgaggactctgaaccccctgggaaataacccaatgaacatt
ccagcaggaggaatcacaacagatcagcaaccaccaaacttgatttcagaatcagctctt
ccaacttccctcggggccacaaacccactgatgaatgacggctccaactcgggcaacatt
ggcaccctcagcactataccaacagcagcacctccttccagcactggtgttcggaaaggc
tggcacgaacacgtcactcaggacctgcggagccatctggtgcataaacttgtccaagcc
atcttcccgacacctgaccccgcagccctgaaggaccggcgcatggagaacctggtggcc
tatgccaagaaagtggaaggggacatgtatgagtccgccaacagcagggatgaatactat
cacttattagcagagaaaatctacaagatacaaaaggaactagaggaaaaacggaggtcg
cgtttacacaaacaaggcatcttgggtaaccagccagccttgccagcccccgggacgcag
ccccctgggataccacaggcacaacctgtgagacctccgaatgggcccatgtccctgcca
gtgaatcgcatgcaggtttctcaagggatgaattcatttaacccaatgtccttggggaat
gtacagttgccacaagctcccatgggaccgcgttcagcgtcccccatgaaccactctgtc
ccgatgaacagcatgggctccgttccagggatggccatttctccttcccgaatgcctcag
cctccgaacatgatgggtgcgcatgccaacaacatgatggcccaggcgcctgcacagaac
cagttcctgccacagaaccagttcccgtcatccagcggggcgatgagtgtgaacagtgtg
ggcatggggcagccggcggcacaggccggagtgtcacagggacaagtgcctggtgctgct
cttcctaaccctctgaacatgcttgggccccaggccagccagctgccttgcccaccagtg
acacagtcacctttgcatcagacgccacctcctgcttccacggccgcgggaatgccatct
ctccagcatccagcagcacctgggatgactcctccccagccagcagctcccacccagcca
tcgactcctgtgtcgtcttccgggcagacccctaccccgactcccggctcagtgcccagt
gctagccaaacccagagcacccctacggtccaggcagcagcccaggcccaggtgacaaca
cagcctcagaccccagtccagcctccgtccgtggccacccctcagtcgtcacagcagcag
ccgacacctgttcatgcccagccccctggcacaccgctttcccaggcagcagccagcatt
gataacagggtccccactccatcctcagtggccagtaccgaaaccaactcccagcagcca
ggacctgatgtaccaatgctggaaatgaaagctgaagtcaagaccgaggacaccgagcct
gatgccagcgaacccaagggagagcctgggtctgcgatgatggaggaggatttacaagga
tcttctcaagttaaagaagaaacagacccagcagagcagaaatcggaaccaatggaagtg
gatgaaaagaaacctgaagtgaaagtcgaagctaaagaggaagaagagagcagcgcaaat
gggacggcctctcagtcaacttctccttcgcagcctcgcaaaaagatctttaagccggag
gagttacgccaggctctgatgccaaccctagaagcactgtatcgacaggatccggagtcc
ttaccttttcggcagcctgtagatccccagctcctaggaattccagattattttgacatt
gtgaagaatcccatggacctttccaccatcaagcggaagctggatacagggcagtaccag
gaaccctggcagtatgtggacgatgtctggctcatgttcaacaacgcctggctctataat
cggaagacgtcccgggtctacaagttctgcagtaaactcgcagaggtctttgagcaagaa
attgaccctgttatgcagtcccttggatattgctgtggacgcaagtatgagttttcccct
cagactttgtgctgctacgggaagcagctgtgtacaattcctcgcgatgctgcgtactac
agctatcagaacaggtatcatttctgtgagaagtgtttcacagagatccagggggagaat
gttaccctgggtgacgacccttcacaaccccagacgacaatttcaaaggatcagtttgaa
aagaagaaaaatgataccttggatcctgaacctttcgttgactgcaaggagtgtggccgg
aagatgcatcagatctgtgttctccactatgatatcatttggccttcaggctttgtgtgt
gacaactgcttgaagaaaactggcaggactcgaaaagaaaacaaattcagtgctaagaga
ctgcagaccacacgattgggaaaccacttagaagaccgagtgaacaagtttttgcggcga
cagaatcatcctgaagctggggaggtctttgtccgcgtggtggccagctcagacaagacg
gtggaggtcaagccggggatgaagtcacggtttgtggattcaggggaaatgtctgaatct
ttcccatatcgaaccaaagcactctttgcctttgaggaaattgacggagtggatgtgtgc
ttctttgggatgcacgtccaggagtatggctctgactgcccccctccaaacacaaggcgt
gtgtacatatcttatctggacagtattcatttcttccgaccccgatgtctccgaacagcc
gtttaccatgagatccttattggatatttagagtatgtgaagaaattggggtatgtaaca
gggcacatctgggcctgtcccccaagtgagggagacgactacatcttccactgccacccc
cctgatcagaaaatcccgaagccgaagcgcctgcaggagtggtacaagaagatgttggac
aaggccttcgccgagcggatcatccatgactacaaggacattttcaaacaagcaactgaa
gataggcttaccagcgccaaggagctgccctattttgagggtgacttctggcccaacgtg
ctggaggagagcattaaggagctggagcaggaggaagaggagaggaagaaggaggagagc
accgcggccagtgagaccacggagggcagccagggcgacagcaagaatgccaagaaaaag
aacaacaagaaaaccaataagaataagagcagcatcagccgagccaacaagaagaagccc
accatgcccaacgtgtccaacgacctgtcccagaagctctacgccaccatggagaagcac
aaagaggtcttctttgtgatccacctccatgccggacctgtcatcaacacgctgcccccc
atcgttgaccccgaccccctgctcagctgtgacctcatggatgggcgggatgccttcctc
accctggccagggacaagcactgggagttctcctccctgcggcgctccaaatggtccacg
ctctgcatgctggtggagctgcacacccagggccaggaccgcttcgtctacacctgcaac
gagtgcaagcaccatgtggagacgcgctggcactgcaccgtgtgtgaggactatgacctt
tgcatcaactgctacaacacaaagagccacacccacaagatggtgaagtgggggctgggc
ctggacgacgagggcagcagccaaggcgagccccagtccaagagcccccaggagtcgcgg
cgcctgagcatccagcgctgcatccagtccctggtgcacgcctgccagtgccgcaatgcc
aactgctcgctgccgtcctgccagaagatgaagcgggtggtgcagcacaccaagggctgc
aagcgcaagaccaacggcggatgcccggtgtgcaagcagctcattgccctctgctgctac
cacgccaaacactgccaagaaaacaagtgccccgtacccttctgcctcaacatcaaacac
aagctccgccagcagcagatccagcaccgcctgcagcaggcccagctcatgcgccggcgg
atggccaccatgaacacccgcaacgtgcctcagcagagcctgccttcccctacctcagcc
cctacctcagcaccgcccgggacccccacacagcagcccagcacgccccagacaccgcag
cctcccgcccagccccagccctcacctgtcagcatgtcaccagctggcttccccaacgtg
gcgcggactcagccccccacgacggtgtccaccgggaagcccaccaaccaggtgccggcc
ccgccgccccctgcccagcccccacccgcggcggtggaggccgccaggcagatcgagcgg
gaagcccagcagcagcagcacctgtaccgggtgaacatcaacaatggcatgcccccgggg
cgcacgggcatggtgaccccggtgagccagatggcccctgtgggcctgaacgtgccccga
cccaaccaggtcagtgggcccgtcgtgcccaacctgccgcctgggcagtggcagcaagcg
cccatcccccagcagcagccaatgccgggcatgccccgtcctgtgatgtccatgcaggcc
cagccggctgtggccgggccacggatgcccagtgtgcagccaccccggagcatctcgccc
ggggccttgcaggacctgctgcggaccctgaagtcacccagctccccacagcagcagcag
caggtgctcaacatcctcaagtccaaccctcagctgatggcagctttcatcaaacagcgc
acggccaagtacgtggccagccagcctggcctgcagccccagcctggcctccaggcccag
cccggccttcagccccagcccagcctgcaccagcagcccagcctgcagaacctgaacacc
atgcaagccggcgggcctcggccgggcgtgcctccacagcagcaggcaatgggtggcctc
aacccccagggccaggccctgaacatcatgaacccggggcacaaccccagcatggcgagt
atgaacccacagtaccgagagatgctgcgaaggcagctcctgcagcagcagcagcagcag
cagcaacagcagcagcagcagcagcagcagcaacagcagcaacagcagcagcagccaccg
ggtggcgcaggcatggccgggggcatggcagggcacagccagttccagcagcctcaagga
cccggaggctacccgccggccatgcagcagcagcggatgcagcagcacctccccatccag
ggcagctccatgggccagatggcagctcagatgggacagcttggccagatggggcagccg
gggctgggtgcagacagcgcccccaacatccagcaggccctgcagcagcggattctgcag
cagcagcagatgaagcagcagatcgggtccccaggccagccgaaccccatgagcccccag
cagcacatgctctcaggacagccacaggcctcgcacctccccggccagcagatggccacg
tcccttagtagccaggtgcggtctccggcccctgtccagtctccacggccccagtcccag
cctccacattccagcccgtcgccacggatacagccccagccttcaccgcaccatgtctcg
ccccagactggttctccccacccaggactcgcagtcaccatggccagctccatagatcag
ggacacttggggaaccccgaacagagtgcaatgctcccccagctgaacacccccaacagg
agtgcgttgtccagtgagctgtccctggtcggcgacaccacaggagataccctagaaaag
tttgtggagggtttgtag

DBGET integrated database retrieval system