KEGG   Camelus ferus (Wild Bactrian camel): 102505971Help
Entry
102505971         CDS       T02979                                 

Gene name
GTF3C4
Definition
general transcription factor IIIC, polypeptide 4, 90kDa
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
Enzymes [BR:cfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102505971 (GTF3C4)
Transcription machinery [BR:cfr03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     102505971 (GTF3C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 742 aa AA seqDB search
STARSIAVLELICDVHNPGQDLVIHRTSVPAPLNSCLLKVGPKTEVAECKEKFATSKDPT
VSQTFMLDRVFNPEGKALPPMRGFKYTSWSPMGCDANGRCLLAALTMDNRLTIQANLNRL
QWVQLVDLTEIYGERLYETSYRLSKSEAPEGNLGDFAEFQRRHSMQTPVRMEWSGICTTQ
QVKHNNECRDVGSVLLAVLFENGNIAVWQFQLPFVGKESISSCNTIESGINSPSVLFWWE
YEHNNRKMSGLIVGSAFGPVKILPVNLKAVKGYFTLRQPVVLWKEMDQLPVHSIKCVPLY
HPYQKCSCSLVVAARGSYVFWCLLLISKAGLNVHNSHVTGLHSLPIVSMTADKQNGTVYT
CSSDGKVRQLIPIFTDVALKFEHQLIKLSDVFGSVRTHGIAVSPCGAYLAVITTEGMVNG
LHPVNKNYQVQFVTLKTFEEAAAQLLESSVQNLFRQVDLIDLVRWKILRDKHIPQFLQEA
LEKKIESSGATYYWRFKLFLLRILYQSMQKTPSEALWKPTNEDSKILLVDSPGMGNADDE
QQEEGTSSRQAAKQGLQERSREGDPEDPTDDSLTQSGDIGGREPMEEKLLEIQGKIEAVE
MHLTREHMKRVLGEVYLHTWITENTSIPTRGLCNFLMSDEEYDDRTARVLIGHISKKMNK
QTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRRCLLHDSIARHPAP
EDPDWIKRLLQSPCPFCDSPVF
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
tccacggcccgcagcatcgctgtgctggagctcatctgcgacgtgcacaacccgggccag
gacctggttatccaccgcacgtcggtgcccgcgcctctcaacagctgcctcctcaaagtg
ggcccaaaaacagaagttgctgagtgtaaggagaaatttgccacctccaaagaccccaca
gtcagtcagactttcatgttggatagggtgttcaaccctgaggggaaggcgttgccacca
atgagaggattcaaatacaccagctggtcccccatgggttgtgatgccaacggcaggtgc
ctcttggcagcactgaccatggacaatcgcctgaccatccaggcaaacctcaacagactg
cagtgggtccagctggtcgatctgactgagatttacggagaacgtctttatgagaccagt
tacagactctctaaaagtgaggccccagaagggaatctcggggactttgctgagtttcag
aggaggcacagcatgcagacaccagtcagaatggagtggtcgggcatctgtaccactcag
caggtcaagcacaacaatgagtgccgcgacgtgggcagcgtgctcctggccgtcctcttt
gagaacgggaacatcgccgtgtggcagtttcagctcccgtttgtaggaaaggaatctatc
tcttcctgcaacacgattgagtcgggaatcaactctcctagtgtcctgttttggtgggag
tacgagcacaacaaccggaagatgagcggcctcattgtggggagtgcttttgggcccgtg
aaaattctccctgtcaacctcaaagccgttaaaggctacttcactctgaggcagcctgtc
gtcttgtggaaagaaatggaccagttgccagtgcacagcatcaagtgtgtcccattgtac
cacccttaccagaagtgtagttgcagcttagtggtggctgccagaggatcctatgtgttc
tggtgtcttcttctgatctccaaagcaggtctgaatgttcacaattctcacgtcacaggc
cttcactcgctgcccatcgtctccatgacggcggacaagcagaatggaacggtgtatact
tgttccagtgatggcaaggtgaggcagctgattcccatcttcacagacgtcgcgttgaag
tttgagcaccagttgattaaactctcagatgtgttcggctcggtgaggacacacgggata
gcagtgagcccctgcggcgcgtacctggccgtcattacaaccgagggcatggtcaatggc
ctccatcccgttaacaaaaactaccaggttcagttcgttactctgaaaacctttgaagag
gcagcggctcagcttctggaatcctcagttcagaatctctttaggcaggtagatttaata
gacctagtacgctggaagattttaagagacaagcatatccctcaatttttacaagaagct
ttggaaaaaaagattgaaagcagtggggccacctattattggcgtttcaaactcttcctc
ctgaggattttgtatcagtcaatgcagaaaaccccttcagaagccttgtggaaacccaca
aacgaggactcaaaaatcttactagttgactcacctgggatgggcaatgctgacgatgaa
cagcaagaagaaggcacttcctccagacaggcggctaagcaaggccttcaggagaggagc
agggaaggtgacccagaggaccccacagatgactcactcactcagtctggagatattgga
ggccgagagccaatggaagagaaactccttgagatccaggggaaaatcgaagctgtggag
atgcacttgacccgggagcacatgaagcgagtcttaggagaagtgtacctgcacacctgg
atcacagaaaacaccagcatccccaccaggggcctctgtaactttttaatgtctgacgaa
gagtatgatgacagaacagctcgggtgctgatcggacacatctcaaagaagatgaacaag
cagacgttccccgagcactgtagtttgtgtaaagagatcttgccgttcacagatcgcaag
caggcagtctgctccaacggccacatttggctccggtgctttttaacctaccagtcctgc
cagagtttgatatacagaaggtgtttgctgcatgacagcatcgcccgccacccggcgccg
gaagatcctgactggattaagagattgctgcaaagcccctgccccttctgtgattctcct
gtcttctga

DBGET integrated database retrieval system