KEGG   Camelus ferus (Wild Bactrian camel): 102506357Help
Entry
102506357         CDS       T02979                                 

Definition
lysozyme C-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    102506357
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102506357
Exosome [BR:cfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102506357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 108 aa AA seqDB search
MKALLVLGLVLLAVAVQGKVWERCELARKLKELGMDGYRGVSVADWMCLARWESNYDTKA
TNFNPSSRSTDYGIFQINSRYWCNDGKTPKAVNGCGINCNDLIQNHVV
NT seq 323 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctccttgtgctggggctcgtcctcctcgctgtcgccgtgcagggcaaggtc
tgggagagatgcgagctggcccgaaagctgaaggaactcggaatggatggctacagggga
gtcagcgtggccgactggatgtgtttggccagatgggaaagtaattatgacacgaaagct
acaaacttcaatccctccagcagaagcactgattatgggatatttcagatcaacagccgc
tactggtgtaacgatggcaaaactccaaaagcagtgaacggctgtggcatcaactgtaac
gatctaattcagaatcatgtggt

DBGET integrated database retrieval system