KEGG   Camelus ferus (Wild Bactrian camel): 102506927Help
Entry
102506927         CDS       T02979                                 

Gene name
GBA2
Definition
glucosidase, beta (bile acid) 2
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102506927 (GBA2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102506927 (GBA2)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102506927 (GBA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 919 aa AA seqDB search
MGTGVPASEQTSCAKGDPQVYCPEDTGGTEAVQATDCESPEDNQSQNEPGYSSREDTGQL
MASYEGKAKGYQVPPFGWRICLAHEFTEKRKPFNANDVSLSNLIKHLGMGLRYLQWWYRK
TQVEKKTPFIDLINCVPLRQIYGCPLGGIGGGTITRGWRGQFCRWQLNPGMYQHQTVIAD
QFTVCLRRKGHTVYQQVLSMERPSVLRSWNWGLCGYFAFYHALYPRAWTVYQLPGQNVTL
TCRQITPILPHDYQDSSLPVAIFVWDVENEGDEAVDVSIMFSMRNGLGGEDDAPGGLWNE
PFCLERDGATVQGLLLHHPTLPNPYTMAVAARLMADTTVTHITAFDPDSTGQQVWQDLLQ
DGQLDSPAGRSPTSQKGEGIAGAVCATGKLPPRGRRSLEFSLAWDMPRIMFGAKGQVHYR
RYTRFFGPDGDAAPTLSHYALCRYTDWEEKISAWQSPVLDDRSLPAWYKSALFNELYFLA
DGGTVWLEVPEASLPEELVGSMHQLHPILREYGRFGYLEGQEYRMYNTYDVHFYASFALI
MLWPKLELSLQYDMALATLREDLTQRRYLMSGIMAPVKRRNVIPHDIGDPDDEPWLRVNA
YVVHDTADWKDLNLKFVLQVYRDYYLTGDQSFLRDMWPVCLAVMESEMKFDKDQDGLIEN
GGYADQTYDGWVTTGPSAYCGGLWLAAVAVMVRMAALCGAPDVQDKFSSILSRGQEAYER
LLWNGRYYNYDCSSQPQSFSIMSDQCAGQWFLRASGLGEGDSEVFPTQHVVRALQTIFEF
NVQAFAGGAMGAVNGMQPHGVPDRSSVQSDEVWVGVVYGLAATMIQEGLTWEGFRTAEGC
YRTVWERLGLAFQTPEAYCQQRVYRSLAYMRPLSIWAMQLALQQQQHKKASGPKAKQGTG
LSMGPKLGPKETMANPSPE
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccggagttccagcctcggagcagaccagctgtgccaaaggggatccacaggtt
tattgccctgaagacactggaggcactgaggctgtgcaggctacagactgcgagagccct
gaagacaatcaatcccaaaatgagccgggctacagcagtcgggaggacactgggcagctt
atggcttcctatgagggtaaagctaagggctaccaggtgcctccttttggctggcgcatc
tgcctggctcatgagtttacagagaagaggaaaccctttaatgccaacgacgtctcccta
agcaatctgataaagcatttgggcatgggcttgaggtacttgcagtggtggtaccggaag
acccaggtggagaagaagacacctttcatcgacctcatcaattgtgtgcccctgagacag
atctatggttgtcccttgggtggcattgggggaggcactatcactcgaggatggagaggc
cagttctgtcgttggcagcttaatcctgggatgtaccagcaccagacagtcatcgctgat
caattcacagtgtgtttgcgtcggaaagggcacactgtgtaccaacaagtcctgtccatg
gagcgcccaagtgtcctgcgcagctggaactggggtctgtgtggatactttgcattctac
cacgccctctatccccgagcctggactgtctatcagcttcctggccagaatgtcaccctc
acctgccgccagatcacacccatcttgccccatgactaccaggacagcagcctgcctgta
gcaatcttcgtgtgggacgtggaaaatgaaggggatgaagccgtggatgtgtccatcatg
ttctccatgaggaatggactggggggtgaagatgatgctcctgggggtttgtggaatgag
cccttctgtctggagcgtgatggggcgactgtacaggggctgctgctgcatcatccaacc
cttccaaatccctacacaatggctgtggctgcacgactcatggcagataccacggtaacc
cacatcacagcctttgaccctgacagcactgggcagcaggtgtggcaggatctacttcag
gatggacagctggactcccccgctggccgaagccccacctcgcagaaaggagaaggcatt
gctggggctgtgtgtgccacgggcaagctgccacctagaggccggcgcagcctggagttc
tcactggcttgggacatgcccagaatcatgtttggagcaaagggccaggtccactacagg
cggtacacaaggttctttggccctgatggtgacgcagcacccacacttagccactatgca
ctgtgccgatacacagactgggaagagaagatctcagcttggcagagcccggtattggat
gacagatctctgcctgcctggtacaaatctgcactgttcaatgaactgtacttcctggct
gatgggggcacagtgtggctggaagttcctgaggcctcgctaccagaggagctggtgggg
agcatgcatcagctgcaccctatcctgcgggagtacggtcgattcggctaccttgaaggc
caggaatatcgcatgtacaacacatatgatgtccacttctatgcttcctttgccctcatc
atgctgtggcccaaactcgagctcagcctgcagtatgacatggctctggccactctcagg
gaggacctgacacagcgacggtacctgatgagtgggataatggcacccgtgaaaaggagg
aacgtcatcccccatgacattggggacccagatgatgagccgtggctccgggtcaatgca
tatgtggtccacgatactgcggactggaaagacctgaacctgaagtttgtgctgcaggtt
tatcgggactactacctgacgggtgaccagagcttcctgagggacatgtggcctgtgtgt
cttgccgtgatggagtctgaaatgaagtttgacaaagaccaagatggactcatcgagaat
ggaggctacgcagaccaaacctatgatggatgggtcaccacaggccccagtgcttactgt
ggaggactgtggctggcagctgtggctgtgatggtccggatggctgctctgtgtggggca
ccagatgtccaggataagttttcttccatccttagccggggccaagaagcctatgagaga
ctgctgtggaatggccgctattacaactatgattgcagctctcagcctcagtcctttagc
atcatgtctgaccagtgtgctggccagtggttcctgagggccagtggcctaggagaagga
gacagtgaggtatttcctacccaacatgtggtccgtgctctccaaactatctttgagttc
aatgtccaggcctttgcaggaggggccatgggggctgtgaatgggatgcagccccatggt
gttcctgatagatccagtgtccagtctgatgaagtctgggtgggtgtggtctacgggctg
gcagccaccatgatccaagagggcctgacttgggagggcttccggacagccgaaggctgc
taccgtactgtgtgggagcgcctgggcctggctttccagactcctgaggcatactgccag
cagcgggtgtatcgctcgctggcctacatgcggccactaagcatctgggccatgcagctg
gccctgcagcagcagcagcataaaaaggcctctgggccaaaagccaaacagggcacagga
ctaagcatgggacccaaacttggaccaaaagaaaccatggcaaacccaagcccagagtga

DBGET integrated database retrieval system