KEGG   Camelus ferus (Wild Bactrian camel): 102507660Help
Entry
102507660         CDS       T02979                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
Enzymes [BR:cfr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102507660 (ART4)
Cellular antigens [BR:cfr04090]
 Proteins
  102507660 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 323 aa AA seqDB search
MKLQGQRRASNTDKCCPRTHRRPWTLLPATAAPAVRIRPLRGQLPLVLLLSTLQRPTVAV
KIDFDLAPNSFDDQYQGCKQQVIDELIQGDYFTKELEAHRDYRKVWQFTHVTWLNQAKAL
PKNMSTAHALAILVYSSNNTVQSDFARAMASAARSPQEYKHSFHFKYLHYYLTSAIQLLR
NETVRRNEPLCYEVHHEMKDVYLEAHTGATIRFGQFLSTSLLREEAQKSGNQTLFTILTC
LGAPVQDVSLKKEVLVPPYELFKVINTSYHPRGNWLQLQSTGNLSTYNCQLLKASSKKCI
ATPAVIVSVSFLTSVIISSKGGA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcaagggcaaagaagggcttctaacacagacaaatgctgtccacggacccac
agacgcccgtggactcttctcccagcgactgcagcccctgcggtgagaatccggcccttg
agagggcagcttcctctcgtcctgctgctctccaccctgcagaggcccacggttgcagtt
aaaatcgactttgacttggcaccaaattcctttgatgatcagtaccaaggctgcaagcaa
caggtcatagatgagctgattcaaggggattatttcacaaaagaactagaagcccatagg
gattaccgcaaggtctggcagttcacccatgtaacctggttgaaccaagcaaaagctctc
cccaagaacatgagtactgcacatgccttggccatcttggtttattcatcaaacaacacc
gttcaatcagacttcgctagagccatggccagtgctgctaggtctccacaggaatataaa
cattcattccatttcaaatatctacactactacctgacctcggcaatccagctgctgagg
aacgagactgttaggaggaatgaacccctgtgttatgaggtgcatcacgagatgaaggat
gtctacttggaagcccacacaggtgccaccattcgatttggccagttcctctccacctcc
ctcctaagagaagaggcacagaagtctgggaaccaaacgttatttaccatattaacctgc
ctgggtgcacctgtacaagatgtctctctcaagaaggaggtcctggtccctccctatgag
ttgtttaaagttataaatacaagctaccacccaagaggaaactggttgcaactgcagtca
actgggaacctgagcacgtataactgccagctgctgaaagcttccagcaaaaagtgcatc
gctactcccgcagttattgtttccgtctcctttttgaccagtgtcatcatctcttccaaa
ggtggcgcataa

DBGET integrated database retrieval system