KEGG   Camelus ferus (Wild Bactrian camel): 102507716Help
Entry
102507716         CDS       T02979                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Serotonergic synapse
Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102507716 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    102507716 (PTGS1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102507716 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    102507716 (PTGS1)
Enzymes [BR:cfr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102507716 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 658 aa AA seqDB search
MSRKFSPGAPGIPFASSGALNARLSPSSLSLFAGRRSLSLWFPLLLLLLLPPVTCAAPPA
ILAHSVPNNPLFPLWGPFRRKWLAPRGKQTVNPCCYYPCQHKGVCVRFGLDRYQCDCTRT
GYYGPNCTIPQLWTWLRTSLRPSPSFLHFLLTHGRWFWEFVNATFIRDLLMRLVLTVRSN
LIPSPPTYNLAHDYISWESFSNVSYYTRILPSVPQDCPTPMGTKGKKQLPDAELLSRHFL
LRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQY
HLRLFKDGKLKYQVLDGEVYPPSVEEAPVLMHYPRGVPPRSQMAVGQEVFGLLPGLMLYA
TLWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFD
PELLFGVQFQYRNRIAVEFNQLYHWHPLMPDAFRVGPRDFSYEQFLFNTSMLVDYGVEAL
VDAFSRQTAGRIGGGRNIDAHILHVAVDVIKESRALRLQPFNEYRKRFGMKPYTSFQELT
GEQEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSP
EYWKASTFGGEMGFNIVKTATLRKLVCLNTKTCPYVSFRVPDPGQEDGPDVERPSTEL
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtaagttcagccccggtgccccgggaatcccctttgcctccagtggagccctg
aacgccaggctcagcccgtcatctctctctctctttgcagggcggcggagtctctcgctc
tggttcccgctgctcctgctgctgctgctgccccccgtcacctgtgctgcgccgccagct
atcctagcccattctgtccccaacaacccgctgtttcccttgtggggcccctttcggagg
aagtggctggcgccgaggggcaagcagactgtgaacccctgctgttactatccgtgccag
cacaagggtgtctgtgtccgcttcggccttgaccgctaccagtgtgactgcacccgcacg
ggctattacggccccaactgcaccatccctcagctctggacctggctccggacgtctttg
aggccgagcccctctttcctccacttcctgctgacacatgggcgctggttctgggagttt
gtcaatgccaccttcatccgtgacttgctcatgcgcctggtactcacagtgcgttccaat
cttatccccagcccccctacctacaacttagcgcacgactacatcagctgggagtccttc
tccaacgtgagctattacacgcggattctgccctctgtgccccaagactgccccacaccc
atggggaccaaagggaagaagcagttgccagatgccgagctcctgagccgtcacttcctg
ctcaggaggaagttcatacctgacccccaaggcaccaacctcatgtttgccttctttgcg
caacacttcactcaccagttcttcaaaacttctggcaagatgggtcctggcttcaccaag
gcattgggccacggggtagacctcggccacatttatggggacaatctagaacgtcagtat
cacctgcggctctttaaggatgggaagctcaagtaccaggtgctggacggagaggtgtac
ccgccgtcggtggaagaggcgcctgtgctgatgcactacccgcggggcgtcccgccccgg
agccagatggccgtgggccaggaggtgttcgggctgctgccggggctcatgctctacgcc
acgctctggctgcgggagcacaaccgcgtgtgtgacctgctgaaggccgagcaccccacc
tggggcgatgagcagctcttccagacggcccgcctcatcctgatcggggagactatcaag
attgtgatcgaggagtatgtgcagcagctgagcggctacttcctgcagctcaagttcgac
ccggagctgctgttcggcgtccagttccagtaccgcaaccgcatcgccgtggagttcaac
cagctctaccactggcacccgctcatgcccgacgccttcagggtgggcccccgggacttc
agctacgagcagttcctcttcaacacctccatgctggtggactacggggttgaggccctg
gtggacgccttctctcgccagacggctggccggatcggtggggggaggaacatagatgcc
cacatcctgcacgtggccgtggatgtcatcaaggagtcgcgagcgctgcggctgcagccc
ttcaacgagtaccgcaagaggtttggcatgaaaccctacacctccttccaggagctcaca
ggagagcaggagatggcagctgagctggaggagctatatggagacattgatgccttggag
ttctacccgggactacttcttgagaagtgccacccaaactccatctttggggagagtatg
atagaaattggggctcccttttcccttaagggtctcttagggaatcccatctgttctccg
gagtactggaaggcgagcacatttggtggcgagatgggcttcaacattgtcaagacggcc
acgctgaggaagctggtttgcctcaataccaagacttgtccctatgtctccttccgcgtg
ccagaccctggccaggaggatgggcctgatgtggagcggccatccaccgagctctga

DBGET integrated database retrieval system