KEGG   Camelus ferus (Wild Bactrian camel): 102508845Help
Entry
102508845         CDS       T02979                                 

Definition
neuroendocrine convertase 2-like
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     102508845
Peptidases [BR:cfr01002]
 Serine Peptidases
  Family S8: subtilisin family
   102508845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 431 aa AA seqDB search
HGTRCAGEVSAAANNNICGVGVAYSSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSA
SWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMW
TISINSAINDGRTALYDESCSSTLASTFSNGRKKNPEAGVATTDLYGNCTLRHSGTSAAA
PEAAGVFALALEANLDLTWRDVQHLTVLTSKRNQLHDEVHQWRRNGVGLEFNHLFGYGVL
DAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKENFVRYLEHV
QAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGT
WTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYIDQVVRDYQSKLAMSKKEELEEELDEAV
ERSLKSILGKN
NT seq 1297 nt NT seq  +upstreamnt  +downstreamnt
ccacgggacccgatgcgccggggaagtgtctgccgccgccaacaacaacatctgtggggt
tggagtggcttacagctccaaggtggcaggtatcaggatgttggaccagccttttatgac
ggacatcatcgaggcatcctccatcagccacatgcctcagctgatagacatctacagcgc
cagctggggccccaccgacaacgggaagacggtggatgggccccgggagctcacgcttca
ggcgatggccgacggcgtgaataagggccgagggggcaaaggcagcatctacgtgtgggc
ctccggggacggcggcagctacgacgactgcaactgcgacggctacgcctccagcatgtg
gaccatctccatcaactcggccatcaacgacggccggaccgccctgtacgacgagagctg
ctcctccaccttggcctccaccttcagcaacgggaggaagaagaaccccgaggccggcgt
ggcaaccacagatctgtacggcaactgcactctgaggcattccgggacatctgcagctgc
tcctgaggcagcaggagtgttcgcgctggctttagaggctaacctggatctgacctggag
agacgttcagcatctgactgtgctcacctccaaacggaaccagcttcacgacgaggtgca
tcagtggcggagaaacggcgtcggcctggagtttaaccacctctttggctacggggtcct
tgatgcaggcgccatggtgaaaatggctaaagactggaaaaccgtgcctgagagattcca
ctgcgtgggaggctccgtgcaggaccctgagaaaataccatccactggcaaactggtgct
gacactcacaaccgacgcatgtgaagggaaggaaaacttcgtccgctacctggagcacgt
ccaagctgtcatcacggtcaacgcgaccaggagaggagacctgaacatcaacatgacgtc
gcccatgggcaccaagtccatcctgctgagccggcgcccgagggacgacgactccaaggt
gggcttcgacaagtggcccttcatgaccacccacacctggggggaggacgcccgaggaac
ctggaccctggagctgggctttgtggggagcgcgccccagaagggggtgctgaaggagtg
gacactgatgctacacggcacgcagagcgcgccttacattgaccaggtggtgagggatta
ccagtccaagctggccatgtccaagaaggaggagctggaggaggagctggacgaagctgt
ggagagaagcctgaagagcatcctgggtaagaactag

DBGET integrated database retrieval system