KEGG   Camelus ferus (Wild Bactrian camel): 102510232Help
Entry
102510232         CDS       T02979                                 

Gene name
GLS
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102510232 (GLS)
   00330 Arginine and proline metabolism
    102510232 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    102510232 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    102510232 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    102510232 (GLS)
   04727 GABAergic synapse
    102510232 (GLS)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    102510232 (GLS)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     102510232 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 491 aa AA seqDB search
MDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESA
KKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVN
DLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYV
MQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLC
SIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGL
PAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAK
KLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGH
VEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKEN
QTVHKNLDGLL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggatatgttaagattaactcttcaaacaacatcagatggtgtcatgctagacaaagat
ctttttaaaaaatgtgttcaaagcaacattgttttgttgacacaagcctttagaagaaaa
tttgtcattcctgactttatgtcttttacttcacacattgatgagttatatgagagtgct
aaaaagcagtctggaggaaaggttgcggattatattcctcagctagccaagttcagtcct
gatttgtggggtgtgtctgtttgtacagtagatggacagagacattctattggagatacc
aaagttccattttgtcttcagtcctgtgtaaaacctttgaaatatgccattgctgttaat
gatcttggaacagaatatgtgcatcgatacgttgggaaagagccaagtggattaagattc
aacaaactatttttaaacgaagatgataaaccacacaatcctatggtaaatgctggagca
attgttgtgacttcattaataaagcaaggagtgaataatgctgaaaaatttgactatgta
atgcagtttttgaataagatggctggtaatgaatatgttggattcagtaatgcaacgttt
cagtctgaaagagaaagtggagatcgaaattttgcaataggatattacttaaaagaaaaa
aagtgttttccagaaggcacagacatggttggtatattagacttctatttccagctgtgc
tccattgaagtaacttgtgaatcagctagtgtgatggctgcaacactggctaatggtggt
ttctgcccaattactggtgaaagagtactgagccctgaagcagttcgaaatacactcagt
ctgatgcattcctgtggcatgtatgatttctcagggcagtttgctttccatgttggtctt
cccgccaaatctggagttgctgggggcattcttttagttgtccccaatgtcatgggcatg
atgtgctggtctcctcctctggacaaaatgggcaatagtgttaagggaattcacttctgt
catgatcttgtttctctgtgtaatttccataactatgataatttgcgacactttgcaaaa
aaacttgatcctcgaagagaaggtggtgatcaaagggttaagtcagtgataaaccttttg
tttgctgcatatactggagatgtgtctgcacttcgaagatttgctttgtcagccatggac
atggaacagcgagactatgattctagaacagctctccacgtggctgctgcagagggtcat
gttgaagttgttaaatttttgctggaagcctgcaaagtaaatcctttccccaaggacagg
tggaataacactcccatggatgaagcgctgcactttggccaccatgacgtatttaaaatc
ctgcaggaataccaagttcagtacacgcctcaaggagattccgacaatggaaaggaaaat
cagaccgtccataagaatcttgatggattgctataa

DBGET integrated database retrieval system