KEGG   Camelus ferus (Wild Bactrian camel): 102510598Help
Entry
102510598         CDS       T02979                                 

Gene name
PCSK1
Definition
proprotein convertase subtilisin/kexin type 1
Orthology
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     102510598 (PCSK1)
Peptidases [BR:cfr01002]
 Serine Peptidases
  Family S8: subtilisin family
   102510598 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 753 aa AA seqDB search
MERRAWTLQCTAFALFCSWCALNSVKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSVPRDSALNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYSSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWNSVPGKKECVVKDNDFEPRALK
ANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSSNGFKNWDFMSVHTWGENPTGTWTLRITDMSGRMQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKVVDSGEEQPTQENLDENPLTSKSPSGGNVGGRRAELAE
GPPSEAMLRLLQSAFSKNFPPKQPPKKSPSAQLNIPYENFYKALEKLNKPSQLKDSEDSL
YNDYVDVFYNTKPYKHRDDRLLQALVDILREDS
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaagagcctggactctgcagtgcactgcttttgctctcttttgctcttggtgt
gcattgaacagtgtaaaagcgaagaggcagtttgtgaatgaatgggcggcagagataccc
ggcggaccggaggcagcctcggcaatagccgaggagctgggctatgacctcttgggtcag
attggatcacttgaaaatcactacttattcaaacataaaaaccatcctcggaggtctcga
aggagtgcctttcatatcactaagagattatctgatgatgatcgtgtgatatgggctgaa
caacagtatgaaaaagagagaagtaaacgttcagttccaagagactcagcactaaatctc
ttcaatgatccaatgtggaatcagcagtggtacttgcaagatactaggatgactgcagcc
ctgcccaagctggatctccatgtgatacctgtttggcaaaaaggcatcacaggcaaagga
gttgttatcactgtactggatgatggcttggaatggaatcacacagatatctatgccaat
tatgatccagaggctagctatgattttaatgataatgaccatgatccatttccccgatat
gatcccacaaatgagaacaaacatgggaccagatgtgcaggagaaattgccatgcaagca
aataatcacaagtgcggggtcggagtcgcatacagctccaaagttggaggcataagaatg
ctggatggcattgtgactgatgctattgaagccagttcaattggatttaatcctggacat
gtggatatttacagtgcgagctggggccctaatgatgatgggaagactgtggaagggcct
ggccgactagcccagaaggcttttgaatacggtgtcaaacagggaagacaaggaaagggc
tctatcttcgtctgggcttctgggaatggggggcgtcagggagataactgtgactgtgac
ggatacacggacagcatctacaccatctccatcagcagtgcctcacagcaaggcctatcc
ccgtggtatgctgagaagtgctcctccaccctggccacctcctacagcagcggggattac
accgaccagcgaatcacgagcgctgacctgcacaatgactgcaccgagacccacacgggc
acctcggcctctgcacccctggctgctggcatcttcgccctggccctggaagcaaatcca
aacctcacctggcgagatatgcagcacttggttgtctggacctctgagtatgacccactg
gccaataaccctggctggaaaaagaatggagcaggcttgatggtgaatagtcgatttgga
ttcgggttgctaaatgccaaagctctggtggatttagctgatcccagaacctggaacagt
gtgcctgggaagaaagagtgtgttgtaaaggacaatgactttgagcccagagccctgaaa
gctaacggagaagttatcattgaaattccaacaagagcttgtgaaggacaagaaaatgct
atcaagtcactggaacatgtgcaatttgaagcaacaattgaatattcccgcagaggagac
cttcatgtcaccctcacttctgctgctggaaccagcactgtactgttggctgagagagag
cgggatacatcttctaatggctttaagaattgggacttcatgtctgttcacacgtgggga
gagaatcccacaggcacttggactttgcgaattacagacatgtctggaagaatgcaaaat
gaaggaagaatcgtgaactggaagttgattctgcatgggacctcttctcagccagaacac
atgaaacagccccgggtgtacacatcctacaacactgttcagaatgaccgaagaggggtg
gagaaggtggtggattcaggggaggagcagcccacacaagagaacctggatgagaaccct
ctgacatccaaaagccccagcggtggcaatgtggggggcagaagggctgaactggcagag
ggacccccttccgaggccatgctgcgactcctacaaagcgctttcagcaaaaacttcccc
ccaaagcaaccaccaaagaagtctccaagtgcgcagctcaacatcccttatgaaaatttc
tacaaagccctggaaaagctgaacaagccttcccagcttaaagactctgaggacagtctg
tataacgactatgtcgatgttttctataacacgaaaccttacaagcacagggacgaccgg
ctgctgcaagctctggtggacattctgcgggaggacagttaa

DBGET integrated database retrieval system