KEGG   Camelus ferus (Wild Bactrian camel): 102511907Help
Entry
102511907         CDS       T02979                                 

Gene name
NCOA1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Estrogen signaling pathway
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    102511907 (NCOA1)
   04919 Thyroid hormone signaling pathway
    102511907 (NCOA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102511907 (NCOA1)
   05224 Breast cancer
    102511907 (NCOA1)
Enzymes [BR:cfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102511907 (NCOA1)
Chromosome [BR:cfr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102511907 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 1441 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDEVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQEDTNSGMSIPRVNPSINPNISPAHGVARSSALPPSNSNMVSTRVNR
QQSSDLHSSSHSNSSNSQGTFGCSPGNQIVASVALNQGQASSQSTNPSLNLNNSPMEGTG
ISLAQFMSPRRQVSSGLATRPRMPNNSFPPNIPTLTSPVSMTSTACNNSNRSYSNIPVTP
LQSMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
SSNDGKPLDSGLLHNNDRLSDGDNKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEVLSC
TGTSNSASANSSSGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS
VTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
MDSCNTNPTPMTKPAPEDIKLESQSQFTADLDQFDQLLPTLEKAAQLPGLCETERMDGAV
TSVTVKSEILPASLQSTTARPTSRLNRLPELELEAIDNQFGQPGTGDQVPWANNTVTAVN
QNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLSSPFQGMVRQKPSLGT
MPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AASAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF
GNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASPSPFSQLAANPEASLAN
RNSMVNRGMTGNMGGQFGTGINPQMQQNVFQYPGSGMVPQGEASFAPSLSPGSSMVPMPI
PPPQSSLLQQNPPASGYQSPDMKAWQQGAMGNNNVFSQAVQNQPTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSSDLLKTE
ADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTAGPQTPQAQQKSLLQQLLT
E
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagttcatctgaccctgctaatccagactcccataagagaaaa
ggatcgccatgtgacacactggcatcaagcactgaaaagaggcgcagggagcaagaaaac
aaatatttagaagagctagctgagttattgtctgccaacattagtgacattgacagcttg
agtgtaaagccagacaaatgcaagatactgaagaagacagtcgatcaaatacagctaatg
aagagaatggaacaagagaaatcaacaactgatgatgaagtacagaaatcagacatctcg
tcaagtagtcaaggagtgatagaaaaggaatccttgggacctcttcttttagaggctttg
gatggatttttctttgttgtgaactgtgaagggagaatcgtatttgtgtcagagaatgtg
accagctacttaggttacaatcaggaggaattaatgaataccagtgtctacagcatactg
catgtgggggatcacgcggaatttgtgaagaatctgctaccaaaatcgctagtaaatgga
gttccttggcctcaagaggcaacacgacgaaatagccatacctttaactgcaggatgcta
attcaccctccagatgagccaggtaccgagaaccaagaagcttgccagcggtatgaagta
atgcagtgtttcactgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgtttgatttgtattgcacggcgattacctcggcctccggctattacgggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatactagttccctg
agagctgctggcagaactggctgggaagatttagtgaggaagtgcatttatgcttttttc
caacctcagggccgagagccatcttatgccagacaactgtttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgct
cacaccaagtgtaaactttgctatcctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggaacacagtggtctttctcctcaagaggacactaattctgga
atgtcaattcctcgggtaaacccttccatcaaccctaatatctctccagctcatggtgtg
gcccgttcatctgcattgccaccatcaaacagcaacatggtatccaccagagtaaaccgc
caacagagctcagaccttcatagcagcagtcatagtaattctagcaacagccaagggact
tttggatgctcacctggaaatcagattgtagccagtgttgccttaaaccagggacaggcc
agttcccagagcactaatccctctttaaacctcaataattctcctatggaaggtacagga
atatcccttgcacagttcatgtctccaaggagacaagttagttctggattggcaacaagg
cccaggatgccaaacaattcatttcctcctaatattccgacattaacctcccctgttagc
atgacaagtactgcctgtaataatagtaaccgatcttattcaaacatcccagtaacacct
ttacagagtatgaatgaaggacccaataactctgttggcttctctgccagttctccagtc
ctcaggcagatgagctcacagaattcacctagcagattaaatatccaaccagcaaaagct
gagtccaaagataacaaagagattgcatccattttaaatgaaatgattcagtctgacaac
agctctaatgatggcaaacctctggattctgggcttctgcataacaatgacagactctca
gatggagacaataaatattctcaaaccagtcacaaactagtgcagcttttgacaacaact
gcagagcagcagttacggcatgctgatatagacacaagttgcaaagaggtactatcttgc
acaggcacttccaactctgcctctgctaactcttcaagcggttcttgcccctcctctcat
agctcactgacagagcggcacaaaattctacaccggctcttacaggagggtagcccctcg
gatatcaccactttgtcagtggagcctgataaaaaggacagtgcatctacttctgtgtca
gtgactggacaggtacaagggaactccagtataaaactagaactggatgcttcaaagaaa
aaagaatcaaaagaccatcagctcctacgctaccttttagataaagatgagaaagattta
agatcaactccaaacctgagcttggatgatgtaaaggtgaaagtggaaaagaaagaacag
atggattcttgtaacacaaacccaaccccaatgaccaaacctgctcctgaggatattaaa
ctggagtcgcagagccagtttacagctgaccttgaccagtttgatcagttactacccacg
ctggagaaggcagcacaattgccaggcttatgtgagacagagaggatggatggtgcggtc
accagtgtcaccgtcaagtcggagatcctgccagcttcacttcagtccaccacggctaga
cccacttccaggctgaacagattacctgagctagaattggaagcaattgataaccaattt
ggacaaccaggaacaggtgaccaggttccatgggcaaataatacagtgacagctgtaaat
cagaataaaccagaagaccagtgtattagttcacaattagatgagcttctctgtccacca
acaacagtagaaggaagaaatgatgagaaagctcttcttgagcagctggtatcctttctc
agtggcaaagatgaaactgagctggctgaactggacagagctctgggaattgacaaactt
gttcagggtggtggattagatgtattatcagagagatttccaccacaacaagcaacacca
cctttgatgatggaagaaaggcccaacctttattcccagccttattcttctccttcacct
actgccaatctctctagccctttccaaggcatggtcaggcaaaaaccttcactggggact
atgcctgttcaagtaacacctccccgaggtgctttttcacctggcatgggcatgcagccc
aggcaaactctaaacagacctccagctgcacccaaccaacttagacttcagcttcaacag
cgattacagggacaacagcagttgatacaccagaatcgtcaagctatcttgaaccagttt
gcagcaagcgctcctgttggcatcaatatgagatcaggcatgcagcagcaaattacacct
cagccacccctgaatgcccagatgttggcacagcgccagcgggagttgtacagtcaacag
caccgacagaggcagctaatacagcagcagagagccatgctaatgaggcaacaaagcttt
gggaacaacctccctccctcatctggactgccagttcaaatggggaacccccgtcttcct
cagggtgctccacagcaattcccctacccaccaaactatggtacaaatccaggaacccca
cctgcttctcctagcccattttcacaactggcagcaaatcctgaggcatccttggccaac
cgcaacagcatggtgaacagaggcatgacaggaaacatgggaggacagtttggcactgga
atcaatcctcagatgcagcagaatgtcttccagtatccaggatcaggaatggttccccaa
ggtgaggccagctttgctccatctctaagcccggggagctccatggtgccgatgccaatc
cctcctcctcagagctctctgctccagcagaatccacccgcttctggctaccagtcacca
gacatgaaggcctggcagcaaggagcaatgggaaacaacaatgtgttcagtcaagctgtc
cagaaccagcccacgcctgcacagccaggagtgtacaacaatatgagcatcaccgtgtcc
atggctggtggaaacacaaatgttcagaacatgaacccaatgatgggccagatgcaaatg
agctctttgcagatgccaggaatgaacactgtttgccctgagcagataaatgatccagca
ctgagacacacaggcctctactgcaaccagctctcatccagtgaccttctcaaaacagaa
gccgatggaacccagcaggtgcaacaggttcaggtgtttgctgatgtccagtgtacagtg
aatctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaagccc
acggcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgact
gaataa

DBGET integrated database retrieval system