KEGG   Camelus ferus (Wild Bactrian camel): 102512182Help
Entry
102512182         CDS       T02979                                 

Definition
ribonuclease pancreatic-like
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     102512182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 146 aa AA seqDB search
MVPKFPVLFLLLVLGWVQPSLGSETAAEKFERQHMDSYSSSSSNSNYCNQMMKRREMTDG
WCKPVNTFIHESLEDVQAVCSQKSVTCKNGQTNCHQSTSTMHITDCRETGSSKYPNCAYK
ASNLQKHIIIACEGNPYVPVHFDASV
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggttccgaagttcccggtcctgttcctactgctggtgctggggtgggtccagccttcc
ctgggctcggaaacagcggccgagaagtttgagcggcagcacatggacagctacagctcc
tccagcagcaactccaactactgcaaccaaatgatgaagcgtcgggaaatgacagatgga
tggtgcaagccagtgaacacctttattcatgagtccctggaagatgtgcaggccgtctgc
tcccagaaaagcgtcacctgcaaaaatgggcaaaccaactgccaccagagcacatccacc
atgcacatcacagactgccgtgagacgggcagttccaagtaccccaactgtgcatacaag
gccagcaatctgcagaaacacatcatcatagcctgtgaggggaacccgtacgtgccagtc
cacttcgacgcttcggtgtag

DBGET integrated database retrieval system