KEGG   Camelus ferus (Wild Bactrian camel): 102513914Help
Entry
102513914         CDS       T02979                                 

Gene name
KAT6A
Definition
K(lysine) acetyltransferase 6A
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
Enzymes [BR:cfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102513914 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1876 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKS
IERFLKGQKDVSALFGGGAASGFHQQLRLAIKRAVGHGRLLKDGPLYRLNTKATNVDGKE
SCESLSSLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKKQNTVSKSPFSKVRTGP
GRGRKRKITLSSQSASSSEEGYLERIDGLDFCRDGSVPLKFNKKTKGLIDGLTKFFTPSP
DGRKPRGEVVDYSEQYRIRKKGSRKSSTSDWPADNQDGWDGKQESEERLFGNQEVMTEKD
MELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCE
FCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFL
DHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRF
LIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTG
ICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIV
SNSVVSEEEEEEAEEEQEEPQSQEGDLETSVGKATCRENKEPESCSSVESEKKPEAPAAA
SSARLSKQALPRDSPPANSPPARRGRWPRKSRKAQDRFGDKDPKLLLEETSAPREQYGDC
EEKPEPPPEQDAESEEPPAASQDSPPVLTKPTLKRKKPILHRRRRVRKRKHHNSSVVTET
ISETTEVLDEPFEDSDSERPMPRLEPTFEMDEEEEEEDEGDLFSRGYFHRLSSQDVLRCR
SSSKRKSKDEDEDEESDDADDTPILKPVSLLRKCDVKDSPLEPDVSLPMKKKKGWPKGKS
RKPVHWKKRPGRKPGFKLSREMVPVCAQECLMEPVVPLPKPGRKLRIQENEETIEPKEDL
LLMEERKEEEELPAEAEEVEDGEEEDATGSDVRAASPADSSGPETEAKEPDVGEEEEKPR
VPAEQRPAEEEPQEPEGPEPEEEEDGAAGTAQHEDHDADDEDDGHLESTKKEGPEERPSR
EDAREEPGGRESFLDTNMQSSRETAKDKDETEPDSEEEQTSQEASVVSEHMPGSEDDHEE
DSNSKEELVELKEEEEIPHSELDLETVQAVQSLTREESGEHEAAYQDCDETLAACQTLQS
YTQADEDPQLSLVEDCHASEHNSPMSSVQSHPSQSVRSVSSPSVPALESGYTQISPEQGS
LSAPSMQNLETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSIC
GNGSSQNSCSFGGLSSSRSLTQSSCVVTQQMAGMGSSCSMLQQNGVQPAANCSIKSPQSC
VVERPPSNQQPXSQCSMNNSFTPAPMIMEIPESGSTGNISIYERIPGDFGAGSYSQPSAT
FSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLAGTPQAQATM
TPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKSAPLPSAAAH
QQQLYGRSPPAVAMQAGPRALAVQRGMNMGVNLMPTPAYNVNSMNMNTLNAMNSYRMTQP
MMNSSYHSNPAYMNQTAQYPMQXSQCLLANASSFYSQQPMQPNPHGNMMYTGPSHHSYMN
AAGVPKQSLNGPYMRR
NT seq 5631 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgctaacccgctgtataccgagtggattttggaggccatcaaaaaagtg
aagaagcagaaacagcgtccttcggaagaaaggatatgcaatgcagtgtcttcatcccat
ggcttggatcgtaaaactgttttagaacaattggagttgagtgtcaaagatggaacgatt
ttgaaagtctcaaataaaggactcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaaacctcgaaaccatgggaaattggataataaacaaaatgtagactggaat
aaactgatcaagcgggcagtcgagggcttagcagagtccggtggctcaactttgaagagc
attgaacgttttttgaaaggtcagaaggacgtgtctgcattatttggaggcggtgccgcc
tctggctttcaccagcagttacgattggctattaaacgtgccgttggccacggcagactc
cttaaagatggacctctttatcggctcaacactaaggcgaccaatgtggatgggaaagag
agctgtgagtctctttcctctttacctccagtgtcactccttccacatgaaaaggataag
ccggttgctgaaccaatccccatctgtagtttctgtcttggtacaaaagaacaaaaccga
gaaaagaagccggaggaactcatctcctgtgcggactgtggcaacagtggtcatccatcc
tgtttaaagttttcccctgaactcacggttagagtgaaggccttacggtggcagtgcatc
gagtgtaagacgtgcagctcctgtcgcgatcagggcaaaaatgcagataacatgctcttt
tgtgattcctgtgaccgaggctttcacatggaatgttgtgatccgccactcacccggatg
ccaaaaggcatgtggatatgtcaaatatgtcgacctaggaaaaaaggacggaaacttcta
cagaagaaggcggcgcagataaaacggcgctatgctaacccaataggacgccccaaaaac
aggttaaagaaacaaaacacggtctcaaaaagtcccttcagcaaagttcgaacaggccct
ggaaggggtcggaaacgtaaaatcactctgtccagccagtcagcatcgtcatccgaagag
ggatatctagagcggatagatggcttggacttctgcagagatggcagtgtccccttgaag
ttcaacaagaaaaccaaagggctcattgatggccttaccaaattctttaccccttcccct
gatgggcggaagccccgaggggaagtggtggactactcggagcaatatagaatcaggaag
aagggcagcaggaaatcaagcacttcggattggcccgcagacaatcaggatggctgggat
ggcaaacaagaaagtgaggaacggctctttgggaaccaggaagtcatgactgagaaagat
atggaattatttcgtgatatccaagaacaagcactgcagaaagttggagtgactggcccg
cctgacccacaagtccgctgtccctctgtcattgagttcgggaagtatgaaatccacacc
tggtactcttccccgtatcctcaagaatactcaaggctgcctaagttgtacctctgtgaa
ttctgtctgaaatacatgaaaagtagaaccattctccagcagcacatgaagaaatgtggt
tggttccatcctcctgctaatgagatttacagaaaaaataatatttcggtctttgaggtt
gatgggaatgtgagtaccatttattgtcagaacctgtgtcttttggcaaagttgtttctt
gaccacaaaacactctattacgatgtggagccatttcttttttatgtactaacacagaat
gatgtcaagggctgccaccttgttggctacttttctaaagaaaagcactgccaacagaaa
tataacgtttcctgtataatgattcttccccagtaccagcgcaagggctacggcaggttt
ctcattgatttcagttatttgttatcaaagcgtgaaggccaagcagggtctccagagaaa
ccattatctgacctcggtcgtctttcctacatggcttattggaaaagtgtaatattggag
tgcctttatcaccaaaatgacaaacaaatcagcattaagaagttaagtaagttgactgga
atctgccctcaagacatcacttccacactccaccacctacgaatgctggacttccggagc
gaccaatttgtgattatccgccgggaaaaacttattcaggatcacatggcaaagctccag
ctgaatttgcggcccgtggatgtggatccggaatgtttgcgctggactcctgtcatagtc
tccaactctgtggtctcggaggaggaggaggaggaggcggaggaagaacaggaggagcct
cagagccaggaaggagacttagagacgagtgtggggaaggctacctgccgtgagaacaaa
gaaccggagtcgtgttcttccgtggagagtgagaagaagcccgaagcgccggcagcggcc
agttccgcgcggctgagcaagcaggcccttccccgggacagccctcctgccaacagcccg
ccggcccgcaggggccgctggcccaggaagagccggaaagcccaggaccgcttcggcgac
aaggacccgaagctgctcttggaggagacgtcagccccccgggagcagtatggggactgc
gaggagaagccagaaccgcccccggagcaggacgccgagagcgaggagccgccggccgcc
tcccaggactcgcccccggtgctcaccaagcccacgctgaagcgcaagaaacccattctt
caccgaagaaggagagtccgaaagcgcaaacaccacaacagcagtgtggtcacggagacc
atctctgagaccaccgaggtcttagacgagccctttgaagactctgactccgagaggccg
atgccgaggttggagcccacgtttgagatggacgaggaagaggaggaggaagatgagggc
gacctcttctctagagggtacttccaccgcttgtcctctcaggatgtcctcaggtgtcgc
tcctcttctaagaggaagtcgaaagatgaagacgaagacgaagagtcagatgacgctgac
gatactcctatcctaaagccagtatctctcctgagaaaatgtgacgtgaaggattctccg
cttgagccagacgtgtccctgcccatgaagaagaagaaggggtggcccaaaggcaagagc
cgcaaaccggtccactggaagaagaggcctggccgcaagccggggttcaagctgagccgg
gagatggtgcccgtgtgtgcgcaggaatgcctcatggagcccgttgtcccgcttcccaaa
cccggacggaaactcagaattcaagagaacgaagagaccattgaaccaaaagaagacttg
cttttaatggaggaaaggaaggaagaggaggagctgcccgcggaggcagaagaggttgag
gacggggaggaggaggacgccaccggcagcgacgtcagggcggcctccccggcggacagc
agcggccccgagacggaggcgaaggagcccgacgtgggcgaggaggaggagaagccccgc
gtccccgcggagcagcgtccggcggaggaggagcctcaggagccggaggggccggagccc
gaggaggaggaggacggggctgcagggaccgcccagcacgaagaccacgacgccgacgat
gaggacgacggccacctggagtccacaaagaaggaggggcccgaggagcggccatcccgg
gaggacgccagggaggagcctggcggccgggagtcttttttagatactaacatgcagagc
agcagggagacggccaaggataaagatgaaaccgagccggattctgaagaggagcagacc
tcccaggaggcgtccgtggtgtccgagcacatgccgggctccgaggatgaccacgaggag
gactcgaactccaaggaggagctggtggagttgaaggaggaggaggagatccctcacagc
gagctggacctggagaccgtgcaggccgtgcagtccctgactcgggaggagagcggcgag
cacgaggccgcctaccaggactgcgacgagaccctggcggcctgtcagaccctgcagagt
tacacccaggccgacgaagacccgcagctttccctggtggaggactgccacgcctcggag
cacaacagcccgatgtcctctgtccagtcgcaccccagccagtcggtgcgctcggtcagc
agccccagcgtgcccgccctggaaagtggctacacccagatcagcccggagcaaggatcc
ctgtccgcaccctctatgcagaacttggagaccagccccatgatggatgtgccttccgtt
tcagaccactcccagcaggtggtggacagtggcttcagtgacctgggcagcattgagagc
accacggagaactacgagaaccccagcagctacgactccaccatgggcggcagcatctgt
gggaacggctcttcgcagaacagctgctcgttcggcggcttgtcgtcctcccgcagcctc
acccagagcagctgcgtcgtcacccagcagatggccggcatgggcagcagctgcagcatg
ctgcagcagaacggggtccagcccgccgccaactgcagcatcaagtcgccgcagagctgc
gtggtggagcggcctcccagcaaccagcagccnnagtctcagtgcagtatgaataacagt
ttcaccccagcgcccatgatcatggagatcccggagtccggaagcacggggaacataagt
atctatgagaggatcccgggggactttggtgccggcagctactcccagccgtcagccacc
ttcagtttagccaagttgcagcagctgactaacaccattatggaccctcatgccatgcct
tatagccattctcctgctgtaacttcctatgcaaccagtgtttctctgtccaacacaggg
ctggctcagctggctccatctcacccgttagctgggacccctcaagcacaagccaccatg
acgccgcccccaaacttggcctccaccaccatgaacctcacgtcccctctgctgcagtgc
aacatgtctgccaccaacattggcattccccacacgcagaggttgcaagggcagatgccc
gtcaaggggcacatttccatccgctccaagtccgcgccgctgccctccgcggcggctcac
cagcagcagctgtacggccgcagcccgcccgcggtcgccatgcaggccggcccgcgtgcg
ctggctgtccagcgtggcatgaacatgggggttaatttaatgccaacccccgcctataat
gtcaattccatgaacatgaacaccttgaacgccatgaacagctatcgaatgacacagccc
atgatgaacagcagttaccatagtaaccctgcctacatgaaccagacagcacagtatcct
atgcaataatcacagtgtcttttggcaaacgcatcctccttttacagccagcagcctatg
cagccaaaccctcatggaaacatgatgtacactggcccctcccatcacagctacatgaac
gccgccggcgtgcccaagcagtcactcaacggaccttacatgagaagatga

DBGET integrated database retrieval system