KEGG   Camelus ferus (Wild Bactrian camel): 102514794Help
Entry
102514794         CDS       T02979                                 

Gene name
BAP1
Definition
(RefSeq) BRCA1 associated protein 1
  KO
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102514794 (BAP1)
Peptidases [BR:cfr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102514794 (BAP1)
Ubiquitin system [BR:cfr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    102514794 (BAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 646 aa AA seqDB search
MFFAHQLIPNSCATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAK
AHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHGPWGED
EEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKYEARLHVLKVNRQTVLEAL
QQLIRVTQPELIQTHKSQESQLPEESKPASSKSPLALEASRATAASEDGVEEVAGSCPQA
PSHSPPSKPKLVVKPPGSGLNGVPPNPTPIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGR
SRVPVRPPQQYSDDEDDYEDDEEDDVQNTNSAIRYKRKGPGKPGPLSGSGDGQLSVLQPN
TINVLAEKLKESQKDLSIPLTIKTSSGAGSPAVAVPMHSQPSPTPSNESTDTASEIGSAF
NSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLH
LAEDGVLSPLALTEGGKGSSPSIRPSQGSQGSGSPEEKEVVETVDSREKPGLVRPSEPLS
GEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLA
QEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgttctttgcccaccagctgatccccaactcttgtgccactcatgccctgctgagcgtg
ctcctgaactgcagcagtgtcgacctggggcccaccctgagtcgcatgaaggacttcacc
aaaggcttcagccctgagagcaaaggatatgcgattggcaatgctccggagttggccaag
gcacataatagccatgccaggcctgagccacgccacctaccggagaagcagaacggcctt
agtgcggtgcggaccatggaggcattccacttcgtcagttatgtgcctattacaggccgg
ctttttgagctggatgggctgaaggtctaccccattgaccatgggccctggggggaggat
gaggagtggacagacaaggcccggcgggtcatcatggagcgtattggcctcgccactgca
ggggagccctaccatgacatccgcttcaacctgatggcggtggtgcccgaccgcaggatc
aagtacgaggccaggctgcatgtgctgaaggtgaaccgtcagacagtactggaggccctg
cagcagttgattagggttacacagccagagctgattcagacccacaagtctcaagagtca
cagttacctgaagagtccaaaccagccagcagcaagtcccccctggcgctggaggcaagc
agggccacggcggcctctgaggatggtgtggaggaggtggctggttcatgcccacaagcc
ccatcccacagtcctcccagcaaacccaagctggtggtgaagcctccagggagtggcctc
aacggggttccccccaaccctactcctattgtccagcggctgccggcttttctggacaat
cacaactatgccaagtcccccatgcaggaggaggaagacctggcagcaggtgtgggccgc
agcagagttccagtccgcccaccccagcagtactcagatgatgaggatgactacgaggat
gatgaggaggatgacgtgcagaacaccaactctgctatcaggtataagcgaaaggggccg
gggaagccagggccattgagtggctctggggatggccagctgtcagtgttgcagcccaac
accatcaacgttttggccgagaagctcaaagagtcccagaaagacctctcaatccctctg
accatcaagacgagcagcggggccgggagtccggctgtggcagtacccatgcactcgcag
ccctcacctacccccagcaatgagagcacggacacagcctctgagatcggcagtgctttc
aattcgccactgcgctcacccatccgctcggccaacccgacacgaccctctagccccgtc
acctcccacatctccaaagtgctttttggagaggacgacagcctgctgcgtgttgactgc
atccgctacaatcgcgctgtacgagacctgggtcctgtcatcagcacaggcctgctgcac
ctggctgaggatggcgtgctgagtcccctagcactgacagagggtgggaagggttcctcg
ccttccatcagaccgagccaaggcagccaggggtctggcagcccagaggagaaggaggtg
gtggaaactgtggacagcagagagaagcctggactggtcaggcctagtgagcccttgagc
ggggagaagtactcacccaaggagctgctggcattgctgaagtgtgtggaggctgagatt
gcaaactatgaggcttgcctcaaggaagaggtggagaagaggaagaagttcaagattgac
gaccagagaaggacccacaactacgatgagttcatctgcaccttcatctccatgctggct
caggaaggcatgctggccaacctagtggagcagaacatctcagtgcggcggcgccaaggg
gtcagcattggccggctccacaagcagcggaagcctgaccggcggaaacgctcgcgcccc
tacaaagccaagcgccagtga

DBGET integrated database retrieval system