KEGG   Camelus ferus (Wild Bactrian camel): 102515577Help
Entry
102515577         CDS       T02979                                 

Gene name
GLS2
Definition
(RefSeq) glutaminase 2 (liver, mitochondrial)
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102515577 (GLS2)
   00220 Arginine biosynthesis
    102515577 (GLS2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    102515577 (GLS2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    102515577 (GLS2)
  Nervous system
   04724 Glutamatergic synapse
    102515577 (GLS2)
   04727 GABAergic synapse
    102515577 (GLS2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    102515577 (GLS2)
   05206 MicroRNAs in cancer
    102515577 (GLS2)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     102515577 (GLS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 535 aa AA seqDB search
MLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSQMRHMVRESSSGGL
LDRDLFRKCVSSNIVLLTQAFRKKFVIPDFEEFTSHVDRIFEDAKELTGGKVAAYIPQLA
KSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISVSTLGTDYVHKFVGKEPS
GLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAGNEYMGFS
NATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESGSVMAATL
ANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGAILLVVPN
VMGMMCLSPPLDKLGNSYRGVSFCQKLVSLFNFHNYDNLKHCARKLDPRREGGEVRNKTV
VNLLFAASSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHTEVVKFLIEACKVNPF
VKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTPSETQAEAAAEVLSKENLESMV
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccgcctgggtgatctgctcttctacactattgctgagggacaggaacgaatc
cctatccacaagttcaccactgcactgaaggccactggactgcagacgtcggatccccgg
ctccgggactgcatgagccagatgcgccacatggttcgagagtccagcagtggtggcctc
ttggaccgagatctcttccgaaagtgtgtgagcagcaacattgtgctcctgacccaggca
ttccgaaagaagtttgtcattcctgattttgaggagttcacgagccatgtggaccgcatc
tttgaagatgccaaagagctcactggaggcaaagtggcggcctacatccctcagctggcc
aagtcaaatccagacctgtggggcgtctctctgtgcactgtggatggtcagcggcactcc
gtgggccacacaaagatccccttctgcctgcagtcctgtgtgaagcctctcacctatgcc
atctccgtaagtaccctgggcacagactacgtgcacaagtttgtgggcaaggagcccagc
ggcctgcgctacaacaagctctccctcaacgaggaagggatcccccataaccccatggtc
aatgctggtgccattgttgtgagctccctgatcaagatggactgtaacaaagcagagaag
tttgattttgttttgcaatatctgaacaaaatggctgggaatgaatacatgggtttcagc
aatgccacattccagtcagagaaggaaacaggggatcggaattatgccatcggctattat
ctaaaggaaaagaagtgctttcctaaaggggtggacatgatggctgccctcgatctctac
ttccagctgtgctccgtggaggtgacctgtgaatcaggcagtgtcatggcagccaccctg
gccaacggcgggatctgccccatcacaggcgagagcgtgctgagcgctgaagcagtgcgc
aacaccctcagcctcatgcactcctgcggcatgtacgacttctcgggccagtttgccttc
cacgtgggtctgccagccaagtcagcggtgtcaggagccatcctcctggtggtgcccaat
gtcatgggaatgatgtgtctgtcacctccactggacaagctggggaacagctataggggc
gtcagcttctgccagaagttggtgtctctcttcaatttccacaactatgacaacctgaag
cactgtgctcggaagttagacccacggcgtgaagggggagaagttcggaacaagactgtg
gtgaacctgttatttgctgcctctagtggagatgtctcagctcttcgaaggtttgccttg
tcagccatggacatggaacagaaagactatgactcccgcacagctctgcatgttgctgca
gctgaaggacacactgaagtcgttaaattcctgattgaggcttgcaaagtgaatcctttt
gttaaggacaggtggggcaacatccccctggatgatgctgtgcagttcaaccacctggag
gtggtgaaactgctccaagattaccaggactcatacacaccatctgagactcaggctgaa
gcagcagctgaggtcctgtccaaagagaacttagagagcatggtgtga

DBGET integrated database retrieval system