KEGG   Camelus ferus (Wild Bactrian camel): 102516612Help
Entry
102516612         CDS       T02979                                 

Definition
NADH-cytochrome b5 reductase 2-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    102516612
Enzymes [BR:cfr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     102516612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 276 aa AA seqDB search
MNFKRRHPITLQDPETKYPLPLIEKEQISHNTRRFRFGLPSPDHALGLPVGNYVHLLAKI
DDVLVIRAYTPVSSDDDLGFVDLIIKIYFKNVHPNHPEGGKMTQYLENMKIGDTILFRGP
SGRLFYQGSGKFAIKPYKMSEPENKLVHHLGMIAGGTGITPMLQLIRCITKKPSDRTRMS
LIFANQTEEDILMRKELEEVARTHPKQFKLWYTLDRPPVGWKYSSGFITEDMIKEHLPPP
GRSTFILVCGPLALIQTAAHPNLEKLGYTKDMIFTY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaagaggagacatcccatcaccttacaggaccctgaaaccaagtaccctctg
cccttgattgagaaagagcaaatcagtcacaacacccggaggttccgctttggactgcca
tcaccagaccatgccttagggcttcctgtaggtaactatgttcatctcttggccaaaatt
gatgatgttttggtgatcagggcttatacgcctgtgtccagtgatgatgatcttggcttt
gtggacttaatcataaagatctacttcaaaaatgtacaccctaatcatccagaagggggg
aagatgactcagtacttggagaacatgaaaattggggacaccatcctttttcgagggcca
tctgggcgcctcttctatcaggggtcagggaagtttgccatcaagccgtacaaaatgagt
gagcctgaaaataaactggtccatcacctgggaatgattgccgggggcacagggatcacg
cccatgctgcagctcatccgctgcatcaccaagaagcccagtgacaggaccaggatgtcc
ctcatctttgccaaccagacagaggaggatatcttgatgagaaaagagcttgaagaagtt
gccagaacccatccaaagcagttcaaactgtggtacaccctggacaggcctcctgttggc
tggaagtacagctcaggcttcattaccgaggatatgatcaaagagcacctcccgcctcct
gggaggtccacattcatcctggtatgtggcccactagccctgatccagacagctgcacac
ccaaacctggagaaactgggttacaccaaggatatgattttcacctactaa

DBGET integrated database retrieval system