KEGG   Camelus ferus (Wild Bactrian camel): 102516884Help
Entry
102516884         CDS       T02979                                 

Gene name
NCOA3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102516884 (NCOA3)
Enzymes [BR:cfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102516884 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1385 aa AA seqDB search
MSGLGENSLDPLAPDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGQGVIDKDSLGPLLLQALDGFLFVVNREGNIVFV
SENVTQYLQYKQEDLVNTSVYHILHEEDRKDFLKNLPKSTVNGVTWTNETQRQKSHTFSC
RMLMKMPHDIMENINTSPEMRQRYETMQCFALSQPRAMMEEGEDLQSCMICVARRVTTGE
RAFPSNPESFITRHDLSGKVVNIDMNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKR
HYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDRHGFVSTHFLQREQNGYR
PNPNPVGQGIRPPAAGCSSAVGGMNMSPSQGLQMLSGRTYGLADPSPAGQMAGARYGASG
SMASVNPGPGMQSPASYQNSSYGLSMSSPPHGSPGLSSSQQSIMISPRNRGSPKMASHQF
SPVAGVHSPMGSSGNTGSHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKLDNSPNMNIT
QPGKVNSQDSRSPLGLYCDQNPVESSMCQSNSRDHHSDKESKESSMEGSENQRGPLESKG
HKKLLQLLTCSSDDRGHSSLTSSPLDSSCKDSAVSVTSPSGVSSSTPGGVSSTSNMHGSL
LQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSGTTSCAEGNVKQEQLSPKKKENNALL
RYLLDRDDPSDTLSKELQPKVEGVDSKMSQCSSSTIPSSSQEKESKIKTEASEEGSGDLD
NLDAILGDLASSDFYSNSISTNSSNLGTRQQQMFQGANSLGLRSPQPVQSVRPPCNRAVS
LDSPVSVGSSPPVKNMSAFPMLPKQPMLGGNPRMMDGQENYGSNMGGPNRNVTVNQTPSS
GDWGLPNPKASRMEPVNSNSMGRPETEYNASLPRPPVGGSVPTMPLRSSSIPGARPMLQQ
QQQMLQMRPGEIPMGMGVSPYVQAAPSNQPGSWPDGMLSMEQGPHGTQNRPLLRNSLDDL
LGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIPELVNQGQALEPKQDAFQG
QEAAVMMEQKTALYGQTYPAQGPPMPGGFNLQGQSPSFNSMMNQMNQQGSFPLQGVHPRA
NIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEMKMENPTAGGAAVMRPMMQPQVNSQ
GFLNAQMVAQRSRELLSHHFRQQRVAVMMQQTQTQPQPQAFSPPPNVTASPGMDGVLPGP
AMPQAPPQQFAYPPNYGMGQQPDPAFGRVSSPPNAMMSSRMGPSQNPMMQHPQTTPMYQS
SEMKGWPSGTLARNSSFSQQQFAHQGNPAAYSMVHMNGSSGPMGQMAMNAMPMAGMPMGP
DQKYC
NT seq 4158 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggagagaactctttggatccactggcccctgattcacgaaaacgcaag
ttgccatgtgatactccaggacaaggtcttacctgcagtggtgaaaagtggagacgggaa
caggagagtaaatatattgaagaattggctgaactgatatctgctaatcttagtgatatc
gacaatttcaatgtcaaaccggataaatgtgcaattttaaaggaaacagtaagacagata
cgtcaaataaaagagcaaggacaaggagttattgataaagactccttaggaccactttta
cttcaggcattggatggtttcctctttgtggtgaatcgtgaaggaaacattgtatttgtg
tcagaaaatgtcacccagtacctgcagtacaagcaagaggacctggttaacacaagtgtc
taccatatcttgcatgaagaagacagaaaggattttcttaaaaacttacccaaatctaca
gttaatggagttacgtggacaaatgagacccagcgacaaaaaagccatacatttagttgc
cgtatgttgatgaaaatgccacatgatattatggaaaacataaatactagtcctgaaatg
cgccagagatatgaaacaatgcagtgctttgctctgtcccagccacgagctatgatggag
gaaggggaagatttgcagtcctgtatgatctgtgtggcacgccgtgttactacaggagag
agagcatttccatcaaaccctgagagctttattactagacacgatctttcaggaaaagtt
gtcaatatagatatgaattcgctgagatcctccatgaggcccggttttgaagatataatc
cgaaggtgcatccagagattttttagtcttaatgatgggcagtcgtggtcccagaaacgt
cactatcaggaagcttacatccatggccatgcagaaaccccagtgtatcgattctcttta
gctgatggcactatagtgactgcacaaacaaagagcaagctcttccgaaatcctgtaaca
aatgatcgtcacggctttgtctcaacccactttcttcagagggaacagaatgggtataga
ccaaacccaaatcctgttggacaaggcattagacctccagcagctggttgcagcagtgca
gtaggcggcatgaacatgtcgcccagccagggcttacagatgctgagcggcaggacctat
ggcttggctgaccccagccccgcgggacagatggctggagctaggtatggggcttctggt
agcatggcttcagtgaaccccgggccaggcatgcagtcaccagcttcctaccagaacagc
agctacggtctcagcatgagcagccctccgcacggcagtcctggcctcagctccagccag
cagagtatcatgatttctcctcgtaatcgtgggagtccaaaaatggcctcacaccagttt
tctcctgtcgcaggtgtacactctcccatgggatcttctggcaatactgggagtcacagc
ttttctagcagctctctcagtgcccttcaagctatcagtgagggcgtggggacttctctt
ttatctactctgtcttcaccaggccccaaattggataactctcccaatatgaatataacg
cagccaggtaaagttaacagtcaggattccaggagtcccctaggcttgtattgcgaccag
aatccagtggagagttcaatgtgtcagtcaaatagcagggatcaccacagtgacaaagaa
agtaaggagagcagcatggaagggtcagagaatcaaagaggtcctctggaaagcaaaggt
cacaaaaaattattgcagttacttacctgttcttctgatgaccgggggcattcctccttg
accagctcccctctggattcaagttgtaaagactctgccgttagtgtcaccagcccctct
ggggtctcctcttcaacacctggaggcgtgtcctccacgtccaatatgcacgggtcactg
ctgcaggagaagcaccggattttgcacaagttgctgcagaacggaaattcaccagctgaa
gtcgccaagattactgccgaagccactgggaaggacactagtggtacgacgtcttgtgca
gaagggaacgtcaagcaggagcagttaagtcctaagaagaaggaaaataatgctctgctt
agatatcttctggacagggatgaccctagtgacacactctccaaagaactacagcccaaa
gtggaaggcgtggacagtaaaatgagccagtgcagcagctccaccattcccagctcaagt
caagagaaagagtctaaaattaagacagaagcaagtgaagaggggtctggagacttggat
aatctagatgctattcttggtgatctggccagttctgatttttacagtaattccatatcc
acaaacagtagcaatctgggaaccaggcaacaacagatgtttcaaggagctaattctctg
ggtttgaggagtccacagcctgtgcagtctgttcgtccaccgtgtaaccgagcagtgtct
ctagacagccctgtttctgttggctcaagccctccagtaaagaatatgagtgctttcccc
atgttaccaaagcagcccatgttgggtggcaatccaagaatgatggatggtcaggaaaat
tatggctcaaatatgggtggaccaaacagaaatgtgactgtgaaccagactccttcctcg
ggagactggggcttaccaaacccaaaggccagcagaatggaacctgtgaattcaaactcc
atggggagaccagaaacggagtataatgcttctttacccaggcctccagtgggtggctca
gtgcccaccatgcctcttcggtccagtagcatcccaggcgcaaggccgatgttgcagcag
cagcagcagatgcttcagatgcggcctggtgagattcccatgggcatgggagtcagtcct
tatgtccaagcagcaccgtcaaaccaacctggttcctggccagatggcatgctgtccatg
gaacaaggccctcatgggactcaaaataggccacttcttaggaattccctggatgatctc
cttgggccaccttctaacctagaaggccagagcgatgaaagagcattgttggaccagctg
cacacgctcttgagcaacacagatgccacaggcctggaagaaattgacagagctctgggc
attcctgaacttgtaaatcaaggacaagctttggagcccaaacaggatgctttccaaggc
caagaagcagcagtaatgatggagcagaagacagcattgtatgggcagacgtacccagca
caggggcctccaatgccaggaggctttaatcttcagggacagtcaccatcttttaactct
atgatgaatcagatgaaccagcaaggcagttttcctctgcaaggagtgcaccctagggcc
aacatcatgagaccccggacaaacacccccaagcagcttagaatgcagcttcagcagagg
ctgcagggccagcagtttttgaatcagagccgtcaggcacttgaaatgaaaatggaaaac
cccactgctggtggggctgcggtaatgaggcccatgatgcagccccaggtgaactcccag
gggttcctgaacgcccagatggttgcgcagcgcagcagggagctgctaagccatcacttc
cggcagcagagggtggccgtgatgatgcagcagacgcagacgcagccgcagccgcaggcc
ttcagcccgccccctaacgtgaccgcttcccccggcatggatggggttttgccagggcct
gcgatgccgcaagctccaccccagcagtttgcatatccaccaaattatgggatgggacag
cagccagatccagcctttggtcgagtgtctagtcctcctaatgcaatgatgtcatcaaga
atgggtccctcccagaatcccatgatgcagcaccctcagaccacacccatgtaccagtcc
tcagaaatgaagggctggccgtcaggaaccctggccaggaatagctccttttcccagcag
cagtttgcccaccaggggaatcccgcggcatatagtatggtgcatatgaacggcagcagt
ggtcccatgggacagatggccatgaacgccatgcccatggccggtatgcccatgggtcct
gatcagaaatactgctga

DBGET integrated database retrieval system