KEGG   Camelus ferus (Wild Bactrian camel): 102516884Help
Entry
102516884         CDS       T02979                                 

Gene name
NCOA3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Endocrine resistance
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102516884 (NCOA3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102516884 (NCOA3)
   05224 Breast cancer
    102516884 (NCOA3)
  Drug resistance
   01522 Endocrine resistance
    102516884 (NCOA3)
Enzymes [BR:cfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102516884 (NCOA3)
Chromosome [BR:cfr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102516884 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 1404 aa AA seqDB search
MSGLGENSLDPLAPDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAISNDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNREGNIVFVSENVTQYLQYKQEDLVNTSVYHILHEEDRKDFLKNLPKSTVN
GVTWTNETQRQKSHTFSCRMLMKMPHDIMENINTSPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRVTTGERAFPSNPESFITRHDLSGKVVNIDMNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRPNPNPVGQGIRPPAAGCSSAVGGMNMSPSQGLQMLSGRTYGL
ADPSPAGQMAGARYGASGSMASVNPGPGMQSPASYQNSSYGLSMSSPPHGSPGLSSSQQS
IMISPRNRGSPKMASHQFSPVAGVHSPMGSSGNTGSHSFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPNMNITQPGKVNSQDSRSPLGLYCDQNPVESSMCQSNSRDHHSDKESK
ESSMEGSENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTSSPLDSSCKDSAVSVTSPSGV
SSSTPGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSGTTSCAEG
NVKQEQLSPKKKENNALLRYLLDRDDPSDTLSKELQPKVEGVDSKMSQCSSSTIPSSSQE
KESKIKTEASEEGSGDLDNLDAILGDLASSDFYSNSISTNSSNLGTRQQQMFQGANSLGL
RSPQPVQSVRPPCNRAVSLDSPVSVGSSPPVKNMSAFPMLPKQPMLGGNPRMMDGQENYG
SNMGGPNRNVTVNQTPSSGDWGLPNPKASRMEPVNSNSMGRPETEYNASLPRPPVGGSVP
TMPLRSSSIPGARPMLQQQQQMLQMRPGEIPMGMGVSPYVQAAPSNQPGSWPDGMLSMEQ
GPHGTQNRPLLRNSLDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIP
ELVNQGQALEPKQDAFQGQEAAVMMEQKTALYGQTYPAQGPPMPGGFNLQGQSPSFNSMM
NQMNQQGSFPLQGVHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEMKMENPT
AGGAAVMRPMMQPQVNSQQGFLNAQMVAQRSRELLSHHFRQQRVAVMMQQTQTQPQPQAF
SPPPNVTASPGMDGVLPGPAMPQAPPQQFAYPPNYGMGQQPDPAFGRVSSPPNAMMSSRM
GPSQNPMMQHPQTTPMYQSSEMKGWPSGTLARNSSFSQQQFAHQGNPAAYSMVHMNGSSG
PMGQMAMNAMPMAGMPMGPDQKYC
NT seq 4215 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggagagaactctttggatccactggcccctgattcacgaaaacgcaag
ttgccatgtgatactccaggacaaggtcttacctgcagtggtgaaaagtggagacgggaa
caggagagtaaatatattgaagaattggctgaactgatatctgctaatcttagtgatatc
gacaatttcaatgtcaaaccggataaatgtgcaattttaaaggaaacagtaagacagata
cgtcaaataaaagagcaaggaaaagctatttccaatgatgatgatgttcagaaagctgat
gtatcttccacaggacaaggagttattgataaagactccttaggaccacttttacttcag
gcattggatggtttcctctttgtggtgaatcgtgaaggaaacattgtatttgtgtcagaa
aatgtcacccagtacctgcagtacaagcaagaggacctggttaacacaagtgtctaccat
atcttgcatgaagaagacagaaaggattttcttaaaaacttacccaaatctacagttaat
ggagttacgtggacaaatgagacccagcgacaaaaaagccatacatttagttgccgtatg
ttgatgaaaatgccacatgatattatggaaaacataaatactagtcctgaaatgcgccag
agatatgaaacaatgcagtgctttgctctgtcccagccacgagctatgatggaggaaggg
gaagatttgcagtcctgtatgatctgtgtggcacgccgtgttactacaggagagagagca
tttccatcaaaccctgagagctttattactagacacgatctttcaggaaaagttgtcaat
atagatatgaattcgctgagatcctccatgaggcccggttttgaagatataatccgaagg
tgcatccagagattttttagtcttaatgatgggcagtcgtggtcccagaaacgtcactat
caggaagcttacatccatggccatgcagaaaccccagtgtatcgattctctttagctgat
ggcactatagtgactgcacaaacaaagagcaagctcttccgaaatcctgtaacaaatgat
cgtcacggctttgtctcaacccactttcttcagagggaacagaatgggtatagaccaaac
ccaaatcctgttggacaaggcattagacctccagcagctggttgcagcagtgcagtaggc
ggcatgaacatgtcgcccagccagggcttacagatgctgagcggcaggacctatggcttg
gctgaccccagccccgcgggacagatggctggagctaggtatggggcttctggtagcatg
gcttcagtgaaccccgggccaggcatgcagtcaccagcttcctaccagaacagcagctac
ggtctcagcatgagcagccctccgcacggcagtcctggcctcagctccagccagcagagt
atcatgatttctcctcgtaatcgtgggagtccaaaaatggcctcacaccagttttctcct
gtcgcaggtgtacactctcccatgggatcttctggcaatactgggagtcacagcttttct
agcagctctctcagtgcccttcaagctatcagtgagggcgtggggacttctcttttatct
actctgtcttcaccaggccccaaattggataactctcccaatatgaatataacgcagcca
ggtaaagttaacagtcaggattccaggagtcccctaggcttgtattgcgaccagaatcca
gtggagagttcaatgtgtcagtcaaatagcagggatcaccacagtgacaaagaaagtaag
gagagcagcatggaagggtcagagaatcaaagaggtcctctggaaagcaaaggtcacaaa
aaattattgcagttacttacctgttcttctgatgaccgggggcattcctccttgaccagc
tcccctctggattcaagttgtaaagactctgccgttagtgtcaccagcccctctggggtc
tcctcttcaacacctggaggcgtgtcctccacgtccaatatgcacgggtcactgctgcag
gagaagcaccggattttgcacaagttgctgcagaacggaaattcaccagctgaagtcgcc
aagattactgccgaagccactgggaaggacactagtggtacgacgtcttgtgcagaaggg
aacgtcaagcaggagcagttaagtcctaagaagaaggaaaataatgctctgcttagatat
cttctggacagggatgaccctagtgacacactctccaaagaactacagcccaaagtggaa
ggcgtggacagtaaaatgagccagtgcagcagctccaccattcccagctcaagtcaagag
aaagagtctaaaattaagacagaagcaagtgaagaggggtctggagacttggataatcta
gatgctattcttggtgatctggccagttctgatttttacagtaattccatatccacaaac
agtagcaatctgggaaccaggcaacaacagatgtttcaaggagctaattctctgggtttg
aggagtccacagcctgtgcagtctgttcgtccaccgtgtaaccgagcagtgtctctagac
agccctgtttctgttggctcaagccctccagtaaagaatatgagtgctttccccatgtta
ccaaagcagcccatgttgggtggcaatccaagaatgatggatggtcaggaaaattatggc
tcaaatatgggtggaccaaacagaaatgtgactgtgaaccagactccttcctcgggagac
tggggcttaccaaacccaaaggccagcagaatggaacctgtgaattcaaactccatgggg
agaccagaaacggagtataatgcttctttacccaggcctccagtgggtggctcagtgccc
accatgcctcttcggtccagtagcatcccaggcgcaaggccgatgttgcagcagcagcag
cagatgcttcagatgcggcctggtgagattcccatgggcatgggagtcagtccttatgtc
caagcagcaccgtcaaaccaacctggttcctggccagatggcatgctgtccatggaacaa
ggccctcatgggactcaaaataggccacttcttaggaattccctggatgatctccttggg
ccaccttctaacctagaaggccagagcgatgaaagagcattgttggaccagctgcacacg
ctcttgagcaacacagatgccacaggcctggaagaaattgacagagctctgggcattcct
gaacttgtaaatcaaggacaagctttggagcccaaacaggatgctttccaaggccaagaa
gcagcagtaatgatggagcagaagacagcattgtatgggcagacgtacccagcacagggg
cctccaatgccaggaggctttaatcttcagggacagtcaccatcttttaactctatgatg
aatcagatgaaccagcaaggcagttttcctctgcaaggagtgcaccctagggccaacatc
atgagaccccggacaaacacccccaagcagcttagaatgcagcttcagcagaggctgcag
ggccagcagtttttgaatcagagccgtcaggcacttgaaatgaaaatggaaaaccccact
gctggtggggctgcggtaatgaggcccatgatgcagccccaggtgaactcccagcagggg
ttcctgaacgcccagatggttgcgcagcgcagcagggagctgctaagccatcacttccgg
cagcagagggtggccgtgatgatgcagcagacgcagacgcagccgcagccgcaggccttc
agcccgccccctaacgtgaccgcttcccccggcatggatggggttttgccagggcctgcg
atgccgcaagctccaccccagcagtttgcatatccaccaaattatgggatgggacagcag
ccagatccagcctttggtcgagtgtctagtcctcctaatgcaatgatgtcatcaagaatg
ggtccctcccagaatcccatgatgcagcaccctcagaccacacccatgtaccagtcctca
gaaatgaagggctggccgtcaggaaccctggccaggaatagctccttttcccagcagcag
tttgcccaccaggggaatcccgcggcatatagtatggtgcatatgaacggcagcagtggt
cccatgggacagatggccatgaacgccatgcccatggccggtatgcccatgggtcctgat
cagaaatactgctga

DBGET integrated database retrieval system