KEGG   Camelus ferus (Wild Bactrian camel): 102517009Help
Entry
102517009         CDS       T02979                                 

Gene name
KAT2B
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102517009 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102517009 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    102517009 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    102517009 (KAT2B)
Enzymes [BR:cfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102517009 (KAT2B)
Transcription machinery [BR:cfr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102517009 (KAT2B)
Chromosome [BR:cfr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102517009 (KAT2B)
   HAT complexes
    PCAF complex
     102517009 (KAT2B)
    STAGA complex
     102517009 (KAT2B)
    TFTC complex
     102517009 (KAT2B)
    SAGA complex
     102517009 (KAT2B)
    SLIK complex
     102517009 (KAT2B)
    ADA-HAT complex
     102517009 (KAT2B)
    HAT-A2 complex
     102517009 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 739 aa AA seqDB search
MKMVWRKQAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCSHALAAHVSHLENV
SEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKK
PPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPND
DISGYKENYTRWLCYCNVPQFCDSLPRYETAQVFGRTLLRSVFTVMRRQLLEQARQEKDK
LPLEKRTLILTHFPKFLSMLEEEVYNQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGT
ISYNSNASSLEQPNGGGPSPSCKGASGLEANPGEKRKMNDSHAAEEAKKPRVMGDIPLEL
IHEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILM
WLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVF
CAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKY
VGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKD
GVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVK
RTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCA
NILEKFFFSKIKEAGLIDK
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggtctggaggaagcaggctgaggaatcttgtaagtgtaatggctggaaaaac
cccaacccgtctcccacgccccccagagctgatctgcagcagataatcgtcagtctgacg
gaatcctgccggagctgtagccatgccctggcggctcacgtttcccacctggagaacgtg
tctgaggaagaaatgaacagactcctgggaatagtgttggacgtggaatatctcttcacc
tgcgtccacaaggaagaagatgcggataccaaacaggtgtatttctacctattcaagctc
ttgagaaagtctattttacaaagaggaaaacctgtggttgaaggctctttggagaagaag
cccccgtttgaaaaacctagtattgaacagggtgtgaataactttgtacagtacaaattc
agtcacctgccgtccaaagagaggcaaacgattgtggagctggcaaaaatgttcctaaac
cgtatcaattattggcacctggaggcaccatcccagcgaagactgcgatctcccaatgat
gacatttccggatacaaagagaactacaccaggtggctgtgttactgcaacgtgccgcag
ttctgtgacagtctgccccggtatgagactgcccaggtgttcgggagaaccctgctccgc
tctgtcttcaccgtcatgaggcggcagctcctggaacaggcgagacaggaaaaagacaaa
ctgccgctggagaaacggaccctaatcctcacccatttcccgaagtttctgtccatgtta
gaagaagaagtttataatcaaaactctcccatctgggatcaggattttctgtctgcttct
tcccgaaccagccagctaggaatccaaacagttatcaatccacctcctgtggccgggacg
atttcctacaattccaatgcatcttccctggagcagccgaatgggggcggccccagtcct
tcctgtaaaggtgcttctgggcttgaggcaaacccaggagaaaagaggaaaatgaatgac
tctcacgctgcggaggaggccaagaaaccccgggtgatgggtgatattcccctggaattg
atccacgaggtcatgtccaccatcacggaccccgcagcgatgctcgggccagagaccaac
tttctgtcagcacactcagcgcgggatgaggcggccaggctggaggagcgcaggggtgtg
attgaatttcacgtggtgggcaactccctgaaccagaagcccaacaagaagattctgatg
tggctggtcgggttgcagaacgtcttctcccatcagctgccccggatgccaaaggagtac
atcacacggcttgtctttgacccgaaacacaaaaccctggctttaattaaagatggccgt
gtcatcggtggcatctgtttccggatgttcccatcccaagggttcacagagatcgttttc
tgcgctgtaacctcaaatgagcaagtcaagggctacggaacgcacctgatgaaccatttg
aaagaatatcacataaaacatgacatcttgaacttcctcacctatgcagatgaatatgcg
attggatatttcaagaagcagggtttctccaaagaaattaaaatccctaaaaccaaatat
gttggctacatcaaggattatgaaggagccactttaatgggatgtgagctaaatccacgg
atcccatacacggaattttctgtcatcattaagaagcagaaggagatcatcaagaagctg
atagaaagaaaacaagcccagattcggaaggtctaccctggactttcctgttttaaagac
ggagttcggcagattccaatagaaagcatcccgggaattcgagagacaggctggaaaccg
agtggaaaagagaaaagtaaagagcccagagaccctgaccagctctacagcaccctgaag
agcatcctccagcaggtgaagagccatcagagcgcttggcccttcatggaacctgtgaag
agaacagaagctccgggatactatgaagttataaggttccccatggatctgaaaaccatg
agcgaacgcctcaagaacaggtactacgtgtctaagaagttattcatggcagacttacag
cgagtcttcaccaactgcaaagagtacaacccccctgagagtgaatactacaaatgtgcc
aacatcctggagaaattcttcttcagtaagattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system