KEGG   Camelus ferus (Wild Bactrian camel): 102517235Help
Entry
102517235         CDS       T02979                                 

Gene name
JOSD2
Definition
Josephin domain containing 2
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102517235 (JOSD2)
Peptidases [BR:cfr01002]
 Cysteine Peptidases
  Family C86
   102517235 (JOSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 188 aa AA seqDB search
MSQAPGAQPSQPSVYHERQRLELCAVHALNNVLQQRLFSQEAADEICKRLAPDSRLNPHR
SLLGTGNYDVNVIMAALQGQGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLP
LRRRHWVALRQVDGIYYNLDSKLRAPEILGDEDGVRAFLAAEMAQGLCEVLLVVTKEVEE
KGSWLRTD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggccccaggagctcagccaagccaaccttccgtgtaccacgaacggcaacgc
ctggagctctgtgccgtccacgccctcaacaacgtcctgcagcagcggctcttcagccag
gaggctgctgatgaaatctgcaagaggttggctccagactcccggctgaacccccatcgc
agcctcctgggcactggcaactatgacgtcaacgtgatcatggccgccctgcagggacag
ggcctagctgccgtgtggtgggacagaaggaggcccctgtcccagctggccctgccccag
gtgctggggctgatcctgaacctgccctcacccgtgtcgctggggctgctgtccctgcca
ctgcgccggcggcactgggtggccctgcgccaggtggacggcatctactacaatctggac
tccaagctgcgggcgcccgagatcctgggggacgaggatggcgtcagggccttcctggcg
gccgagatggctcagggcctgtgcgaggtgctgctcgtggtgaccaaggaggtggaggag
aagggctcctggctgcggacagactga

DBGET integrated database retrieval system