KEGG   Camelus ferus (Wild Bactrian camel): 102518432Help
Entry
102518432         CDS       T02979                                 

Gene name
ART5
Definition
ADP-ribosyltransferase 5
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
Enzymes [BR:cfr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102518432 (ART5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 308 aa AA seqDB search
MLVTLLIALSCLGLHTLWQAQSVPILSLGLAPDTFDDTYVGCSEEMEEKAALLLKEEMAR
HALLRESWETAQEAWEHRHRGLTLPSGFKAHHGIAIMVYTNSSNTLYRELNWAVRTGGSS
WEVYMEYFPFKALHFYLTRALQLLRGSGSCSMGPGEEVFRGVGTLRFEPKRLGDSVRLGQ
FASSSLDESVARRFGNATFFFLRTCFGAPIHALSVFPEEREVLIPPHEVFLVTSFSQDGT
QNLVTLSSSNQICSHFNCAYLGEKKRLSCESVPTGGQPDSSSKGAFSLLSWKTLLLASWG
FQLLVAGP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgactctgttgatcgccctcagctgcctgggcctccacaccctctggcaggcc
cagtctgttcctatcctgtccctgggcctggctccagacaccttcgatgatacctatgtg
ggttgctcagaggagatggaggagaaggcagcccttctgttaaaggaggagatggcccgc
catgccctgctgcgggaatcctgggagacagcccaggaggcctgggagcacaggcatcga
gggctcaccctgccctctggcttcaaagcccatcatggaattgccatcatggtctacacc
aactcatccaacactctgtaccgggaactgaactgggccgtgcggacaggaggcagctcc
tgggaggtctacatggagtacttccccttcaaggccctgcatttctacctgacccgggcc
ctgcagctgctgcgaggcagcggaagctgcagcatgggacctggggaggaggtgttccga
ggcgtgggcacccttcgctttgaacctaagaggctgggggactctgtccgcttgggccag
tttgcctccagctccctggatgagtcagtggcccgcagatttggtaatgccaccttcttt
tttctaaggacttgctttggggccccaatccatgccctgtctgtctttccggaggagcgt
gaggtgctgatacccccgcatgaagtcttcttggtcaccagtttctcccaggatggaacc
cagaacctagtgactctctcaagcagtaatcagatctgcagccactttaactgcgcctat
ctgggtgagaagaagaggctgagctgtgagtctgtgccaacaggagggcagccagactca
tcctccaagggcgccttctctctgctctcctggaagaccctgctcttggcctcttggggg
tttcagctgttagttgctgggccctga

DBGET integrated database retrieval system