KEGG   Camelus ferus (Wild Bactrian camel): 102518571Help
Entry
102518571         CDS       T02979                                 

Gene name
LYZL1
Definition
lysozyme-like 1
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102518571 (LYZL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 148 aa AA seqDB search
MKAASILTLIGCLAMAAEPKVYTRCKLAKIFARANLDNYQGFTLGNWICMAYYESRYNTT
AQTNLEDGSIDYGIFQINSYTWCRRGTLQERNHCHVACSALITDDLTDAIVCAKKIVKET
EGMNYWQGWKKNCEGRDLSEWKRGCNVS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgccagcattttgaccctgattggctgcctggccatggccgctgagcccaaa
gtctacactcgctgtaaactggcaaaaatatttgcaagggctaacctggacaattaccag
ggctttacccttggaaactggatctgcatggcgtactatgagagccgctacaacaccaca
gctcagaccaacctggaggacggaagcatcgactatggcatttttcagataaacagttac
acgtggtgccggcgtgggacgctacaagagagaaaccactgtcacgtagcctgctcagcc
ttgatcactgacgacctcacagatgcgattgtctgtgccaagaaaattgttaaagagaca
gaagggatgaactactggcaaggctggaagaaaaactgtgagggcagagacctctctgag
tggaaaagggggtgcaatgtttcatga

DBGET integrated database retrieval system