KEGG   Camelus ferus (Wild Bactrian camel): 102519858Help
Entry
102519858         CDS       T02979                                 

Gene name
SIRT6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
Enzymes [BR:cfr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102519858 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 324 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEVFDPPEELEQKVWELAQLVWQSSNVVFHTGAGISTASG
IPDFRGPHGVWTMEEQGLAPKFDTTFENARPTKTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECVKCKTQYVRDAVVGSMGLKATGRLCTVAKSRGLRACRGE
LRDTILDWEDALPDRDLALADEASRSDGRPAQGGKLWILFFLTGLTLLLVSVLGGSPQGA
ESWAPDSGADLPFIAPPFSSGGLGRSILALNPDPGAHTPGTCSSPRPQPLTQDVLGRSSY
SPTPAYSKMAFIVPPRGKGGIATI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgctgcggggctgtcgccgtacgcagacaagggcaagtgcggcctg
ccggaggtctttgacccccctgaggagttggagcagaaggtgtgggagctggcgcagcta
gtctggcagtcctccaacgtggtgttccacacaggcgcgggcattagcaccgcctcaggc
atccccgacttcaggggcccccatggcgtctggacgatggaggagcagggcctggcaccc
aagttcgacactaccttcgagaacgcgcggcccacgaagacgcacatggcactggtgcag
ctggagcgcgtgggcctcctccgcttcctagtcagccagaatgtggacgggctgcatgtg
cgctccggcttccccagggacaagttggcagagcttcacggaaacatgtttgtagaagaa
tgtgtcaagtgtaagacgcagtacgtccgggacgccgtcgtgggcagcatgggcctgaag
gccaccggccggctctgcacagtggccaagtcaagggggctgcgggcctgcaggggggag
ctgagagacaccatcctggactgggaggatgccctgcctgaccgggacctggctctcgcc
gacgaggccagcaggtctgacggaagaccagcccagggtgggaaactatggattcttttt
tttcttactggtctcactttgttacttgtctctgtccttggggggagccctcagggcgct
gagagctgggctccagactccggggcagacttgcccttcattgcacccccctttagctct
gggggcctgggaaggagcatcctcgccctaaaccctgaccctggagctcacacccccggc
acctgctcctcccccaggccccagcccctgactcaggatgttcttgggaggtcctcatac
tccccaacccctgcctactccaaaatggccttcatagtccctccacgagggaaaggaggc
atagccaccatttag

DBGET integrated database retrieval system