KEGG   Camelus ferus (Wild Bactrian camel): 102519858Help
Entry
102519858         CDS       T02979                                 

Gene name
SIRT6
Definition
(RefSeq) sirtuin 6
  KO
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    102519858 (SIRT6)
Enzymes [BR:cfr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102519858 (SIRT6)
Chromosome [BR:cfr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     102519858 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 178 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEVFDPPEELEQKVWELAQLVWQSSNVVFHTGAGISTASG
IPDFRGPHGVWTMEEQGLAPKFDTTFENARPTKTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECVKCKTQYVRDAVVGSMGLKATGRLCTVAKSRGLRACR
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgctgcggggctgtcgccgtacgcagacaagggcaagtgcggcctg
ccggaggtctttgacccccctgaggagttggagcagaaggtgtgggagctggcgcagcta
gtctggcagtcctccaacgtggtgttccacacaggcgcgggcattagcaccgcctcaggc
atccccgacttcaggggcccccatggcgtctggacgatggaggagcagggcctggcaccc
aagttcgacactaccttcgagaacgcgcggcccacgaagacgcacatggcactggtgcag
ctggagcgcgtgggcctcctccgcttcctagtcagccagaatgtggacgggctgcatgtg
cgctccggcttccccagggacaagttggcagagcttcacggaaacatgtttgtagaagaa
tgtgtcaagtgtaagacgcagtacgtccgggacgccgtcgtgggcagcatgggcctgaag
gccaccggccggctctgcacagtggccaagtcaagggggctgcgggcctgcaggtga

DBGET integrated database retrieval system