KEGG   Camelus ferus (Wild Bactrian camel): 102520179Help
Entry
102520179         CDS       T02979                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Cholesterol metabolism
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102520179 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102520179 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    102520179 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    102520179 (LPL)
Enzymes [BR:cfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102520179 (LPL)
Exosome [BR:cfr04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102520179 (LPL)
  Exosomal proteins of breast milk
   102520179 (LPL)
Glycosaminoglycan binding proteins [BR:cfr00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   102520179 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cfr00537]
 Enzymes
  102520179 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 478 aa AA seqDB search
MESKALLLVALSVWLQSLTASRGGLATADRITERSDFLDIESKFALRTPEDTVEDTCHLI
PGLTESVANCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRA
QQHYPVSAGYTKLVGKDVARFINWMADELNYPPDNVHLLGYSLGAHAAGIAGSLTNKKVN
RITGLDPAGPNFEYAEAPSRLSPDDAYFVDVLHTFTRGSPGRSIGIQKPVGHIDIYPNGG
AFQPGCNIGEAIRVIAERGFGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSREAF
EKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRAEMPYRVFHYQVKIHFSGTESVTY
TNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWISDSYFSW
SDWWSTPSFPVEKIRVKAGETQKKVIFCSREKMPHLRRGKSPVIFVKCHDKSLNRRSG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagcgctgctcctggtggcgctgagcgtgtggcttcagagtctgaccgcc
tcccgcggagggctggccaccgccgacagaattacggaacgaagtgattttttagacatc
gaaagtaaatttgctctgaggacccctgaagacacggttgaggacacttgccacctcatc
ccgggactgacagagtctgtggctaattgtcacttcaatcatagcagcaaaacctttatg
gtgatccatggctggacggtgacaggaatgtatgagagttgggtgcccaagcttgtggct
gccctgtacaagagggaaccggactccaacgtcatcgtggtggactggctgtcacgggcc
cagcagcattacccggtgtctgcggggtacaccaagctggtgggaaaggacgtggccagg
tttatcaactggatggcggatgaacttaactatcctccggacaacgtccacctcttgggg
tacagccttggagcccatgctgctggcattgcgggaagtctgactaataagaaggtcaac
agaattaccggcctggacccagctggacccaacttcgagtacgcggaggctccgagtcgg
ctttctccggatgatgcgtactttgtggacgtcctacacacgttcaccagggggtcaccc
ggccgaagcattgggatccagaaaccagtcgggcacattgacatttaccctaacggaggc
gctttccagccggggtgcaacatcggggaagctatccgtgtgatcgccgagagaggtttt
ggagatgtggaccagctagtgaagtgctcccatgagcgttccatccatctcttcatcgac
tctctgctgaacgaggaaaacccaagcaaggcctaccggtgcaattcgagggaggccttt
gagaaggggctctgcctgagctgcagaaagaaccgttgcaacaacctgggctacgagatc
aacaaggtcagagccaaaagaagcagcaaaatgtacctgaagacgcgcgcggagatgccc
tacagagtcttccattaccaagtaaagatacatttttctgggaccgagagtgttacctac
accaaccaggccttcgagatctctctgtacggcaccgtggccgagagcgagaacatcccc
ttcaccctgcctgaagtttctacaaataagacgtactcttttctaatttacacggaggtg
gatattggagagctgctcatgttgaaactcaaatggattagtgactcatacttcagctgg
tcagactggtggagcacccccagctttcctgtcgagaagatcagagtaaaggcaggagag
acccaaaagaaggtgatcttctgctccagggagaaaatgcctcatctgcggagaggaaag
tcacctgtgatatttgtaaaatgccacgacaagtctctgaacagaaggtctggctga

DBGET integrated database retrieval system