KEGG   Camelus ferus (Wild Bactrian camel): 102521632Help
Entry
102521632         CDS       T02979                                 

Gene name
ALDH1L2
Definition
aldehyde dehydrogenase 1 family, member L2
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    102521632 (ALDH1L2)
Enzymes [BR:cfr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     102521632 (ALDH1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 709 aa AA seqDB search
MDVIDSPKHGSIIYHPSILPRHRGASAIHNWIRGHDKVPGAWTEINGQMVTFYGSSLLNS
SVPPGEPLEIKGAKKPGLVTKKGLVLFGNDGKALIVRNLQFEDGKMIPASQYFSAGETSV
VELTAEEVKVAEIIKVIWAGILSNVPVIEDSTDFFKSGARSMDVVRLVEEIRQKCGGLQL
QNEDVYMATKFEDFIQKVVRKLRGEDQEAELVVDYISKEVNEMTVKMPYQCFINGQFTDA
DDGKTYDTINPTDGSTICKVSYASLVDVDKAVAAAKDAFENGEWGRMNARERGRLMYRLA
DLLEENQEELATIEALDSGAVYTLALKTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPN
RNLTFTKKEPLGVCAIIIPWNYPLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELS
AKAGFPKGVINIIPGSGGIAGQRLSEHPDIRKLGFTGSTLIGKQIMKSCAVSNLKKVSLE
LGGKSPLIIFNDCELDKAVRMGMGAVFFNKGENCIAAGRLFVEESIHDEFVTKVVEEIKK
MKIGDPLDRSTDHGPQNHKAHLEKLLQYCEAGVREGATLVYGGRQVQRPGFFMEPTVFTD
VEDHMYLAKEESFGPIMVISKFQNGDIDGVLQRANNTEYGLASGVFTGDINKAMYVSEKL
EAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEEALNEYLKTKTVTLEY
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaattgacagcccaaagcatggttccatcatttatcacccgtctatccttccg
aggcacagaggagcctctgctatccataactggattcgaggtcatgataaagtccctgga
gcttggacggagatcaatggacagatggtaactttctatggctcatcactactgaatagc
tccgtgccccctggagaaccactggaaattaaaggtgccaagaagcctggtcttgttacc
aaaaaaggacttgttctttttggtaacgatggaaaagcactgatagtgagaaatctgcag
tttgaagatggaaaaatgattcctgcatctcagtacttttcagcgggtgagacatcagtg
gtagaactaacagctgaagaggtgaaggtggcggagatcatcaaggtcatctgggctgga
attttaagcaatgttcctgttattgaagactcaacagacttctttaaatctggagcacgc
tcaatggatgttgtcaggctagttgaagagatcaggcagaaatgtggagggcttcagtta
cagaatgaagatgtttatatggccaccaagtttgaagacttcatccaaaaagtcgtgagg
aaactgagaggagaagatcaagaagcggagctagtagtggattatatttcaaaggaggta
aatgaaatgacagtaaaaatgccatatcagtgtttcataaatggacagttcacagatgct
gatgatgggaagacttacgacactatcaacccaacagatggatctacaatatgcaaagta
tcctatgcttctttggtggatgttgataaagcagtagcagcagcaaaagatgcttttgaa
aatggtgaatggggaagaatgaatgcaagagaaagaggaagattgatgtacagacttgca
gacctgttggaagagaaccaagaagagctggcaaccattgaagccctcgattcaggagct
gtctataccttggctctgaagactcacattggaatgtctgtacagacattcagatatttt
gctgggtggtgtgacaaaattcagggttctacaattcccatcaaccaggcccgtccaaat
cgcaatctcaccttcaccaagaaggagccacttggtgtctgtgccattatcatcccctgg
aactacccgctgatgatgctggcgtggaagagtgctgcgtgtttggcagcaggcaatacc
ttagtgctcaagccagcgcaggtcacgcccttgactgctttgaagtttgcagagctctca
gctaaagcaggctttccaaagggggtaatcaacatcattccaggttcaggtggcatagca
ggacagcgcctatctgaacatcctgatatccgcaaacttggtttcactggttccactctg
attggcaaacagatcatgaagagctgtgctgtaagcaacttgaagaaagtttcgcttgaa
cttggtggcaaatccccacttataatattcaatgactgtgaacttgacaaggctgtgcga
atgggcatgggagcagtatttttcaacaaaggagagaactgtattgcagctggacggttg
ttcgtggaggaatccatccacgatgaatttgtgacaaaagtggtagaagaaattaaaaag
atgaaaattggtgatccacttgacagatctactgatcacgggccccaaaatcataaggcc
catctggaaaagcttctgcagtactgtgaagctggagtgagagagggggccaccttagtg
tatggaggaagacaagttcaaaggccaggcttttttatggaacctactgtgttcacagat
gtggaagaccacatgtatcttgccaaagaggaatcctttgggcccattatggtcatttct
aaatttcaaaatggggacatcgatggagtgttgcagcgagccaataacacagagtacggt
ttggcctcgggggtttttacaggagacataaataaagctatgtatgtgagtgaaaaacta
gaggcaggaactgtttttattaacacctacaacaagacggatgtggcagccccttttggt
ggatttaaacagtctggctttggaaaagacttaggtgaggaagctctaaacgaatacctc
aaaaccaagactgtgacgctggagtattag

DBGET integrated database retrieval system