KEGG   Camelus ferus (Wild Bactrian camel): 102521689Help
Entry
102521689         CDS       T02979                                 

Gene name
SCD5
Definition
(RefSeq) stearoyl-CoA desaturase 5
  KO
K00507  
stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    102521689 (SCD5)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102521689 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    102521689 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102521689 (SCD5)
Enzymes [BR:cfr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     102521689 (SCD5)
Lipid biosynthesis proteins [BR:cfr01004]
 Desaturase
  First
   102521689 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 367 aa AA seqDB search
MAAEMGSDVVVNWRAPEVACKPNAQGEAWSRFSAGTSSAHTLFSGFNLQNCGSVQWFCGG
WIRGSKSTFKESKEDDLLVSGEGYKRGTYLSLAEGGRRWAWRAGRQGRLAEKKNAYFCFL
LTALGVTAGAHRLWSHRSYKAKLPLRIFLAAANSMAFQNDIFEWSRDHRVHHKYSETDAD
PHNARRGFFFSHVGWLFVRKHRDVIEKGRRLDFTDLLADPVVRFQRKYYKITVVLMCFVV
PTLVPWYIWGESLWNSYFLASILRYTISLNVTWLVNSAAHMYGNRPYDKHISPRQNPLVT
LGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDFMCWLGLATDRKRATKPMIEARKA
RTGDGSA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagagatggggagtgacgtggttgtgaactggagagcaccagaggtggcctgc
aaaccaaatgcgcaaggagaggcctggagcagattctcagcaggaaccagctctgcccac
accttgttttccggctttaacctccagaactgtggatcagtgcagtggttctgtggagga
tggattcgaggcagcaagagtacattcaaggagagcaaggaggatgatttgttggtcagt
ggcgagggctacaagaggggcacctacctcagcctggccgagggtgggaggaggtgggca
tggagggccggccgtcagggaaggcttgcagagaagaagaacgcctacttctgcttcctc
ctgactgctctgggtgtgacagctggtgcccatcgcttgtggagccacaggtcctacaag
gccaagctgcctctgaggatatttctggctgccgccaactccatggctttccagaacgac
atcttcgagtggtccagggaccaccgagtccaccacaagtactcggagacagatgctgac
ccccacaacgcccgccggggcttcttcttctcccacgtcgggtggctgttcgtccgcaag
catcgggatgtcatcgagaaggggaggaggcttgacttcactgacctgctggctgatccc
gtggtccggttccagagaaagtactacaagatcaccgtggtgctcatgtgcttcgtggtc
cccacgctggtgccctggtacatctggggagagagtctgtggaattcctacttcctggcc
tccatcctccgctacaccatctcactcaacgtcacctggctggtcaacagtgccgcccac
atgtacggaaaccggccctatgacaagcacatcagccctcggcagaacccgctcgtcacc
ctgggcgccattggtgaaggcttccataattatcatcacacctttccctttgactactct
gcaagtgaatttggcttaaatttcaacccaaccacctggttcattgacttcatgtgctgg
ctgggactggccactgaccgcaaacgggccaccaagccgatgatcgaggcccggaaagcc
aggactggagacggcagcgcctga

DBGET integrated database retrieval system