KEGG   Camelus ferus (Wild Bactrian camel): 102522017Help
Entry
102522017         CDS       T02979                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  
insulin receptor [EC:2.7.10.1]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Phospholipase D signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Adherens junction
Insulin signaling pathway
Ovarian steroidogenesis
Regulation of lipolysis in adipocytes
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
Aldosterone-regulated sodium reabsorption
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    102522017 (INSR)
   04015 Rap1 signaling pathway
    102522017 (INSR)
   04010 MAPK signaling pathway
    102522017 (INSR)
   04066 HIF-1 signaling pathway
    102522017 (INSR)
   04068 FoxO signaling pathway
    102522017 (INSR)
   04072 Phospholipase D signaling pathway
    102522017 (INSR)
   04022 cGMP - PKG signaling pathway
    102522017 (INSR)
   04151 PI3K-Akt signaling pathway
    102522017 (INSR)
   04152 AMPK signaling pathway
    102522017 (INSR)
   04150 mTOR signaling pathway
    102522017 (INSR)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    102522017 (INSR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102522017 (INSR)
   04923 Regulation of lipolysis in adipocyte
    102522017 (INSR)
   04913 Ovarian Steroidogenesis
    102522017 (INSR)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102522017 (INSR)
  Aging
   04211 Longevity regulating pathway - mammal
    102522017 (INSR)
   04213 Longevity regulating pathway - multiple species
    102522017 (INSR)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102522017 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102522017 (INSR)
   04931 Insulin resistance
    102522017 (INSR)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102522017 (INSR)
Protein kinases [BR:cfr01001]
 Receptor tyrosine kinases
  INSR family [OT]
   102522017 (INSR)
Cytokine receptors [BR:cfr04050]
 Receptor tyrosine kinase
  RTK class II (Insulin receptor family)
   102522017 (INSR)
CD molecules [BR:cfr04090]
 Proteins
  102522017 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 1462 aa AA seqDB search
MFCGGPEEPEIMGFGAGSGRACARGLGKARDGTAHRFSQSLERAGQEWLSAELAMGADCV
RVPAGSGDATHVLFGSSPRSGVTGQPRTAKCLGCTQFGARVEGDGLEVAWGVPAVCPGMD
IRNNLTRLHELANCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESL
KDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATID
WSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVC
PTICKSHGCTAEGLCCHSECLGNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWR
CVNFSFCQDLHNKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVC
HLLEGEKTIDSVTSAQELRGCTIVNGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRR
SYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNP
KLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSHDKILLKWEPY
WPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPMRSNDPKSQNHPGWL
MRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQII
LKWKPPSDPNGNITHYLVFWERQAEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKHNQ
TEYEEAAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFIPRKSSSGPGAEDTRPSR
RRRALADIGNGTAAVPTLPGFPNASSTSAPTSSEEHRPFEKVVSKESLVISGLRHFTGYR
IELQACNQDAPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNG
LIVLYEVSYRRYGDEELHLCVSRRHFALERGCRLRGLPPGNYSVRVRATSLAGNGSWTEA
TYFYVTDYYVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYL
SASDVFPCSVYVPDEWEVPREKIALLRELGQGSFGMVYEGNARDIVKGEAETRVAVKTVN
ESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRP
EAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGM
TRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGL
SNEQVLKFVMDGGYLDQPDNCPDRVTNLMRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPE
VSFFHSEENKAPESEELDMEFEDMESVPLDRSAHSQREEAGGRDAGSALGLKRGYEEHIP
YTHMNGGKRNGRILTLPRSDPS
NT seq 4389 nt NT seq  +upstreamnt  +downstreamnt
atgttctgtgggggccctgaggagccagagatcatgggatttggggctggctcaggcaga
gcctgtgcccgaggtttagggaaggcgcgagatgggacggcccatcgcttcagccagagc
ttggagagggctggccaggagtggttgagtgccgagctagccatgggggctgactgtgtg
agagtcccagctggctccggagacgcgacacacgtcctctttgggtcgtctccgagaagc
ggggtcactggacagcctcggacagccaaatgcctggggtgcacacagtttggagccaga
gtcgagggagacggactggaggtcgcctggggggtcccagctgtgtgccccggcatggac
atccggaacaacctcacccggctgcacgagctggccaactgctccgtcatcgaaggacat
ctgcagatactgctgatgttcaaaacgaggcctgaggatttccgagacctcagtttcccc
aaactcatcatgatcaccgattacttgctgctcttccgggtctacgggctggagagcctg
aaggacctgttccccaacctcacggtcatccggggctcccgcctcttcttcaactatgcg
ctggtcatcttcgagatggttcacttgaaggagcttggcctctacaatttgatgaacatt
acgcggggctcggtccgcatcgagaagaacaatgagctctgctacctggccaccattgac
tggtcgcgcatcctggactccgtggaggataattacatcgtgctgaacaaagatgacaac
gaggaatgtggggacatttgtccaggcactgccaagggcaaaaccaactgccctgccact
gtcatcaatgggcaatttgtcgagcggtgttggacgcacagccactgtcagaaagtttgt
ccgaccatctgcaagtcgcacggctgcaccgcggagggcctctgctgccacagcgagtgc
ttgggtaactgctccgagcccgacgaccccaccaagtgcgtggcctgccgcaacttctac
ctggacggccgctgcgtggagacctgcccgcccccctactaccacttccaagactggcgc
tgcgtgaacttcagcttctgccaggatctgcacaacaaatgcaagaactctcggaggcag
ggctgccaccagtacgtcattcacaataacaagtgcatccccgagtgtccctctgggtac
acgatgaattccagcaacttgatgtgcactccatgcctgggcccctgtcccaaggtctgc
cacctcctggaaggcgagaagaccatcgactcagtgacgtccgcccaggagctccgaggc
tgcaccattgtcaacgggagcttaatcatcaacattcgagggggcaacaatctggcagct
gagctggaggccaaccttggactcattgaagaaatttcagggtacctgaaaatccgccgg
tcctacgccctcgtgtcactttccttcttccggaagttacgtctgattcgaggagagacc
ttggagattgggaactactccttctacgccttggacaaccagaacctaaggcagctgtgg
gactggagcaaacacaacctcaccatcacgcaggggaaactgttcttccactataacccc
aagctctgcttgtcagaaattcacaagatggaggaagtttcaggaaccaaggggcgccag
gagagaaacgacattgccctgaagaccaatggggaccaggcgtcctgtgaaaatgaatta
cttaaattctcttacattcggacatctcatgacaagatcttgctgaaatgggagccctat
tggccccctgacttccgagatctcttggggttcatgcttttctacaaagaggccccttat
cagaacgtgacagagttcgatggacaggatgcgtgcggctccaacagctggacggtggtg
gacattgacccgccgatgaggtccaatgaccccaagtcacagaaccaccccgggtggctg
atgcggggtctcaagccctggacccagtacgccatctttgtcaagaccttggtcaccttt
tctgacgaacgccgcacgtacggggccaagagcgacatcatctatgtccagacagatgcc
actaatccttccgtcccactggatcccatctcggtttctaattcctcatcccagattatt
ctgaagtggaagcctccctctgaccccaacggcaacatcacacactacctggttttctgg
gagaggcaggcggaagacagcgagctgtatgaattggattattgcctcaaagggctgaag
ctgccgtcccggacctggtctccgccgtttgagtctgagggctcccagaagcacaatcag
accgagtacgaggaggctgccggagagtgctgctcctgcccgaagaccgactctcagatc
ctgaaggagctggaggaatcctcgttccggaagacatttgaggattacctgcacaatgtg
gttttcatccccagaaaatcctcttcaggccctggcgcggaggacaccaggccgtcgcgg
agacgcagggccctggctgacatagggaatggcacagcggccgtgcccacgctcccgggg
ttccccaacgcctcctccaccagcgcacccaccagctcggaggagcacagacccttcgag
aaagtggtgagcaaagagtcactggtcatctcggggctgcgtcactttaccggctaccgc
atcgagctgcaggcttgcaaccaagatgcccccgaggagcggtgcagcgtggccgcctac
gtcagcgccaggaccatgcccgaagccaaggccgatgatattgtgggccccgtgacccac
gaaatcttcgagaacaacgtcgtccacctgatgtggcaggagcccaaggaacccaacggt
ctgatcgtgctctatgaagtgagctaccgacgatacggcgatgaggagctgcacctgtgc
gtctctcgaaggcatttcgctctggagcggggctgcaggctgcgcgggctgccgcccggg
aattacagcgtgagagttcgggccacctccctggcgggcaacggctcctggacagaagcc
acttatttctatgtgacagattattacgtcccatcaaatattgcaaagattatcatcggc
cccctcatctttgtatttctcttcagtgttgtgattgggagtatttatctgttcctgaga
aagaggcagccggatgggccactgggaccactgtatgcttcttcgaaccccgagtacctc
agtgccagcgatgtgttcccgtgttctgtgtacgtgccggacgagtgggaggtgccccgg
gagaagatcgcgctgctgcgagagctcgggcagggctccttcggcatggtgtacgagggc
aacgccagggacatcgtcaagggcgaggcggagacccgcgtggcggtgaagacggtcaac
gagtcggccagcctgcgagaacggattgagtttctcaacgaggcctcggtcatgaagggc
ttcacctgccaccacgtggtccgcctcctgggggtggtgtccaaaggccagccgacactg
gtggtgatggagttgatggctcacggagacttaaagagctacctccgttccctgcggccg
gaggccgagaataaccctggtcgccctccccctacgctgcaagagatgattcagatggcg
gcggagattgccgatgggatggcgtacctgaacgccaagaagttcgtgcaccgggacctc
gcagctcggaactgcatggtcgctcatgattttaccgtcaaaatcggagactttggaatg
accagagacatctacgaaacggactactaccggaaagggggcaagggcctgctccccgtg
cggtggatggcacccgaatccctgaaggacggggtcttcaccacttcttccgacatgtgg
tccttcggcgtggtcctctgggaaattaccagcttggcagaacagccttaccaaggccta
tctaatgagcaggtgttgaaattcgtcatggatggagggtatctggatcaacctgacaac
tgtccagacagagtcaccaacctgatgcgcatgtgctggcagttcaaccccaagatgcgg
ccgaccttcctggagatcgtcgacctgctcaaggacgacctgcaccccagctttcccgaa
gtttccttcttccacagcgaggagaacaaggcgccggagagcgaggagctggacatggag
tttgaggacatggagagcgtcccgctggaccggtcggcacactcgcagcgggaggaggcc
gggggccgggacgcggggtcggcgctggggctgaagcggggctacgaggagcacatcccc
tacacccacatgaacgggggcaagaggaacggccgcatcctgaccctgccgcggtccgac
ccttcctaa

DBGET integrated database retrieval system