KEGG   Camelus ferus (Wild Bactrian camel): 102522024Help
Entry
102522024         CDS       T02979                                 

Gene name
TGM5
Definition
transglutaminase 5
Orthology
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
Enzymes [BR:cfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102522024 (TGM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 718 aa AA seqDB search
MAQGLEVALIDLQSSWNNVRHHTEEISSNRLLLRRGQSFNITLYFRNRAFQPGLDDIIFV
AETGPLPDLAKGTRAVFSLAGHSGPSPWIASLETLGATSLEVSLCAPPTAAVGRYLLKVH
IKSLQGPVTAYQLGEFILLFNPWCPGDAVYLDSEPQRQEYVVNDYGFIYQGNKNWIRPCP
WNYGQFEENIIDICLELLDKSLNFQIDPATDCALRGSPVYVSRVVCAMINSNDDNGVLNG
NWGEKYSDGINPTEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDSTGRILENKKKDTVWNFHVWNECWMARKDLPPGYGGWQVLD
ATPQETSNGLYCCGPASVRAIKEGEVDLNYDTAFTFSMVNADCMSWLVFGGKEEKLHRDT
SSVGNFISTKSIQSDERDDITENYKYAEGSPQEREMFLKALQKLKAGRSQGFLGAGSPPS
GSMPPRASPRSLDTPSLRPSDVVRVSLKFQMLDPPDMGQDIRFVLLALNMSDQFKDLKVN
LSAQSLLHDGSPLPPFWQDTAFITLSPEEAKSHPCKIPYSQYSQYLSTDKLIRISALGEE
KSSPEKILVNKIITLAYPGIMINVLGAAIVNQPLSIQVIFSNPLSEQVADCVLTVEGSGL
FRKQQRVLIGVLQPQHRASLTLETVPFKSGQRQIQANLRSNKFKDIKGYRNVYVDFGL
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagggctggaggtggccctcatagacctgcagagctcctggaacaacgtgcgg
caccacacggaggagatcagctccaaccgcctgctcctccgccggggccagagcttcaac
atcaccctgtacttcaggaaccgggccttccagccgggcctggacgacatcatctttgtg
gctgagaccggaccactgccagacctggccaaggggactcgggccgtgttcagcctggca
ggtcacagtggccccagcccctggatcgcctcactggagaccctcggggccacctccctg
gaagtgagcctgtgcgcccctcccacagcggccgtgggtcggtacctgttgaaggttcac
atcaaatccctacaggggcctgtcacagcctatcagctcggagagttcattctactcttc
aacccctggtgcccaggggatgctgtctacttggacagtgagcctcagaggcaggagtat
gtcgtgaatgattacggcttcatctaccaagggaacaagaactggatccgcccctgcccc
tggaactacggacagtttgaggagaacatcatagacatctgcctggagctgctggacaag
agcttgaacttccagatcgacccagccacagactgtgccctgcggggcagccccgtctac
gtcagcagagtggtgtgcgccatgatcaacagcaacgatgacaacggtgtgctcaatggg
aactggggtgagaaatactcagacggcatcaaccccacggagtggacgggcagcgtggcc
atcctgaagcagtggcacgccacaggctgccagccagtgcgctacgggcagtgctgggtc
tttgccgcggtcatgtgcacagtgatgaggtgcctggggatccctacccgcgtgatcacc
aactttgactctggccacgacacagacggaaatctgatcatagatgagtattacgacagc
acaggcaggattttggagaataagaagaaggacaccgtctggaatttccacgtctggaac
gagtgctggatggcccggaaggacctccctcccggatacggaggctggcaggtgctggac
gccacgccacaggagaccagcaatggcctctactgctgcggtcctgcctccgtcagggcc
atcaaagagggagaggtggatctgaactatgacacagccttcaccttttccatggtgaat
gctgactgcatgtcctggctggtctttggagggaaggaggagaaacttcaccgggacacc
agttctgttggtaattttatcagcaccaagagcatccagagcgatgagcgggacgacatc
acagagaactataagtacgcagaaggttccccccaggagagggagatgtttctgaaggct
cttcagaagctgaaagctggaaggtcccaaggcttcctcggagcaggctcgccaccttcc
gggtccatgccacccagggccagtcctcggagcctggatactccttcccttcgtcccagt
gatgttgtccgggtctccctgaagttccagatgctcgacccacccgacatgggccaggac
ataaggtttgtcctgctggccctcaacatgtcagaccagttcaaggacctcaaagtgaat
ctgagtgcccagtctctgctgcatgatggcagccccctgcctccattctggcaggacaca
gccttcatcacactctctcctgaagaagcaaagagccacccctgcaaaatcccctattcc
cagtacagccagtacctgtccacagacaagctgatccgcatcagtgccctgggcgaagag
aagagcagtcctgagaagatcctggtgaacaagatcatcacattagcctatcctggcatc
atgattaatgttttaggagcagccattgtgaaccagccgctctctatacaggtgatcttt
tcaaacccgctctcagagcaggtggcagactgtgtgctgactgtggaaggaagcgggctc
ttcaggaagcagcagagagtcctcattggagtcctccaaccccaacacagagccagcctc
actctggagactgtccccttcaagagtggccaaaggcagatccaagcgaatctgaggagc
aacaagtttaaagacatcaagggttacaggaatgtctatgtagactttgggttataa

DBGET integrated database retrieval system