KEGG   Camelus ferus (Wild Bactrian camel): 102522457Help
Entry
102522457         CDS       T02979                                 

Gene name
TGM7
Definition
transglutaminase 7
Orthology
K05623  
transglutaminase 7 [EC:2.3.2.13]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Brite
Enzymes [BR:cfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102522457 (TGM7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 681 aa AA seqDB search
MGLQRLIVRRSQSFTIQLHFSRPFHSGTDHITFIAETGPEPTELLGTRATFLLTSARQGN
VWSASDFTIDANSLSVSLFTPASAVIGPYTLKIKISQGQGNSLTHLLGTFILLFNPWSAE
DDVYLPSELLLQEYIMMDYGFVYKGHERFITPWPWNYGQFEEGIIDICFEILNKSLSFLE
NPSKACSQRNDVVYVCRVVSAMINSNDDSGVLQGNWGEDYSRGLSPLEWSGSVAILRQWX
GGQPVRYGQCWVFAAVMCTVMRCLGVPTRVVSNFRSAHNADANLTIDTYYDQNAVMLPTQ
KRDKIWNFHVWNECWMIRKDLPPGYNGWQVLDPTPQETSSGLFRCGPASVKAIREGEVHL
PYDTPFVYAEVNADEVIWLFGGGQALEILAHNISSIGKEISTKMVGSDQRQNITSSYKYP
EGSLEERSVFMKASRKMLGSRRASSPFLDLLGSGGSKDQPAQLQLHLAQTPEWGQDLLLE
LHARRVADRAHPQGPIRLVVRFCAQTLLHSGGTRGPLWRQKVHLTLDFGEEIQRSLSLPY
NNYKNKLTDEKLIRVSGIAKVAETGRSMLVLKDISLEPPHLAIEVSERAEVGKALRVHIS
LTNTLSVALSHCTMVLEGSGLIDGQISNDLGTLVAGHTVQIQLDLYPLKAGRRQLQVLIS
SKELKEIKGYKDIFVVAAGAS
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgcagcggctcatcgtgcgccgcagccagtccttcacaatccagctgcatttc
agccgacccttccattctgggaccgaccacatcaccttcatcgctgagacaggaccagag
cccacagagctgctgggaacccgagccaccttcttgctcacctcggcccgacaaggaaat
gtctggagtgcttctgacttcaccatcgacgccaactcgctctctgtctcccttttcaca
ccggccagtgcagtcattggtccttacactttgaagatcaagatctctcagggccagggt
aacagcctgacccacctgctggggactttcatcctgctttttaacccttggagtgcagag
gatgacgtctacctgccaagtgaactactgctgcaggagtatatcatgatggactatggc
tttgtttacaagggtcatgaaagattcatcaccccctggccctggaactacgggcagttt
gaagagggcatcatagatatctgctttgagatcctgaacaagagcctgtccttcttagag
aacccgtccaaagcctgctcccagcggaacgacgtggtgtacgtctgcagggtggtgagc
gccatgatcaacagcaacgacgacagcggcgtgctgcaggggaactggggagaggactac
tccagggggctgagcccgctcgagtggagcggcagcgtggccatcctgcggcagtggngg
ggcgggcagcccgtcaggtacgggcagtgctgggtcttcgcagctgtcatgtgcaccgta
atgaggtgcttaggtgttccaacccgtgtcgtttccaatttccgttctgcacacaacgca
gatgcgaacttgaccatcgatacctactacgaccaaaatgcagtgatgctgccaactcag
aaacgagacaaaatatggaattttcatgtctggaacgagtgctggatgatccggaaagat
ctccctccaggatacaatgggtggcaggttttggaccccactccccaagaaaccagcagt
gggctgttccgctgtggccctgcctccgtgaaggccatcagggaaggggaggtccacctg
ccctacgacaccccttttgtgtatgctgaggtgaatgccgatgaagtcatttggctgttc
gggggtggccaggccctggaaatcctggcccataacatcagttccatcgggaaggaaatc
agcaccaagatggtcgggtcagaccagcgccagaacatcaccagctcctacaagtaccca
gaaggatccctggaggagcgctctgtgttcatgaaggcctcccggaagatgctgggctca
agaagggcctcgtcacccttcctggacctgctggggtccggcggttctaaggatcagccg
gcacagctgcagcttcacctggcccagacgcccgagtggggccaggacctgctgctggag
ctgcatgcccggagggtggcagacagagcccacccccaggggcccatcagactggtggtg
cgcttctgcgcacagaccttgctgcacagcggcggcacccgggggcccctctggaggcaa
aaggtgcacttgaccctggactttggggaggagatacagcgatccctctcgctgccctac
aacaattataaaaacaagctaacggatgaaaagctgatccgtgtgtctggcatcgccaag
gtagcagagacagggaggtccatgctggtcctaaaggatatctctctggagcctccccac
ttagcaattgaggtgtctgagagggccgaggtgggcaaggcactgagagtccacatctcg
ctcaccaataccctctcggtggccctgagtcactgcacgatggtgctggagggcagtggt
ctcatcgatgggcagatatcaaatgaccttgggactctggtggccggacacactgtccaa
attcagctggacctctaccccctcaaagctggacgccgccagttgcaagtcctcatcagc
agcaaagagctcaaggagatcaagggctacaaggacatctttgttgtggcagctggggct
tcttga

DBGET integrated database retrieval system