KEGG   Camelus ferus (Wild Bactrian camel): 102522644Help
Entry
102522644         CDS       T02979                                 

Gene name
F13A1
Definition
coagulation factor XIII, A1 polypeptide
Orthology
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    102522644 (F13A1)
Enzymes [BR:cfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102522644 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 732 aa AA seqDB search
MSEPSGTAFGGRRAVPRNASNAAENDPPTMELQGVLPRSFRLQDYLNVTDVHLFKERWDT
NKVDHHTDKYDNSKLIVRRGQAFYIQIDFNRPYHPTRDLFRVEYVIGRYPQENKGTYIPV
PIVSELQSGKWGAKVIMREDRSVRLSIQSSPNCIVGKFRMYVAVWTPYGIIRTSRNPETD
TYILFNPWCEEDAVYLENDKEREEYVLNDIGVIFYGDFNDIKSRSWSYGQFEDGILDACL
YVMDRAKMDLSGRGNPIKVSRVGSAMVNAKDDEGVIVGSWDNIYAYGIPPSAWTGSVDIL
LEYKSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQLDIFLEEGGN
VDSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQYDAPFVFAEVNGDLVYITAKKDGTHVVENVDTTHIGKLIVTKQIGGDGIKDITD
TYKFQEGQEEERLALETALMYGAKKPLSTEGVVKSKSDVHMNFEVENAVLGRDFKVIVTF
RNNSHARYTITAYLSGSITFYTGVAKEEFKNETFNVTVEPSSFTREEVQIRAGEYMGQLL
EQAFLHFFVTARVNETNDVLAKQKSIVLTIPKVIIKVRGAQMVGSDMVVTVEFTNPLNET
LRNVWIRLDGPGVTKPMRKMFREVRPNATVQWEEMLRPWVSGPRKLIASMSSDSLRHVYG
ELDLQIQRRSSV
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagccctctgggaccgcctttggaggcaggagagccgtcccccgcaacgcgtcc
aatgcggcggagaacgaccccccgacgatggagctgcagggcgtcctgccccggagcttc
cgcctgcaagactacctgaatgtcacggatgttcacctgttcaaggagagatgggacacc
aacaaagtggaccaccacacggacaagtacgacaacagcaagctgattgtgcgcagagga
caggccttctacatccagattgacttcaaccgtccatatcaccccacaagggacctcttc
agggtggagtatgtcattggccgctaccctcaggagaacaagggaacctacatcccagtc
cccattgtctccgagctgcagagtggcaagtggggggccaaagtcatcatgagagaggac
cggtcggtccggctgtccatccagtcttctccaaactgcattgtgggaaaattccgcatg
tacgtcgctgtctggaccccctatggcatcatccgcaccagccggaacccagagacggac
acgtacattctcttcaacccttggtgtgaagaggatgctgtgtacctggaaaatgacaaa
gaaagagaagagtacgtcctgaatgacattggggtcattttttacggagacttcaacgac
atcaagagtagaagctggagctatgggcagtttgaggatggcatcctcgacgcctgcctg
tatgtgatggacagagcaaagatggacctctccggcagagggaatcccatcaaagtcagc
cgcgttgggtctgccatggtcaatgccaaagatgatgaaggcgtcatcgttggatcctgg
gacaatatctatgcttatggcatccccccgtcagcctggacggggagcgtggacattctg
ctggaatacaagagctctgagaacccagtccggtatgggcagtgctgggtttttgctggt
gtcttcaacacgtttttgcgatgcctcgggataccggcaagaatcgttaccaattatttc
tcagcccacgataacgacgccaatttgcagctggacatcttcctggaggaaggtgggaac
gtggactccaaactcaccaaggactcggtgtggaactaccactgctggaatgaagcctgg
atgacgaggcccgatcttcccgtgggattcggaggctggcaagtcgtggacagcaccccc
caggaaaacagcgatgggatgtaccggtgcggcccagcctcagttcaagccattaagcac
ggtcacgtttgcttccagtacgacgcgcccttcgtcttcgcagaggtcaacggtgatctc
gtttacatcacagccaagaaagacggcactcacgtggtggaaaacgttgataccacccac
attgggaaattaatcgtgaccaaacagattggaggcgatggcataaaggatattactgat
acctacaaattccaggaaggtcaagaagaagagaggctggccctggaaactgccctgatg
tatggggcaaaaaagcccctcagcacagagggcgtcgtcaagtcaaagtctgacgttcac
atgaactttgaagtggagaatgctgtgctgggaagagacttcaaggtcatcgtcaccttc
cggaacaacagccatgcccgctacaccatcacagcctacctctccggcagcatcaccttc
tacaccggggtcgccaaggaggaattcaagaacgagacgttcaacgtgacagtggagccc
tcatctttcacgagggaggaggtgcagatcagagcgggcgagtacatgggccagctgctg
gagcaggcgttcctgcacttctttgtcacggctcgggtcaacgagaccaacgacgttctg
gccaagcagaagtccattgtgctgacgatccccaaggtcatcatcaaggtccgtggtgct
cagatggttggctcggacatggttgtgactgttgagttcaccaatcctttaaatgaaact
ctgcgaaacgtgtggatacgcctggatggtcctggagtgacaaaaccaatgaggaagatg
ttccgggaagtccggcccaacgccaccgtgcagtgggaagagatgcttcggccttgggtc
tccgggccccggaagctgatagccagtatgagcagcgactccctgagacacgtgtacggc
gagttggacttgcagatccagagacgatcttctgtgtag

DBGET integrated database retrieval system