KEGG   Camelus ferus (Wild Bactrian camel): 102523872Help
Entry
102523872         CDS       T02979                                 

Gene name
CKM
Definition
(RefSeq) creatine kinase, M-type
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
cfr  Camelus ferus (Wild Bactrian camel)
Pathway
cfr00330  Arginine and proline metabolism
cfr01100  Metabolic pathways
Module
cfr_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:cfr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    102523872 (CKM)
Enzymes [BR:cfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     102523872 (CKM)
Exosome [BR:cfr04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   102523872 (CKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 102523872
NCBI-ProteinID: XP_006176119
UniProt: S9XAH5
Position
Un
AA seq 381 aa AA seqDB search
MPFGNTHNKYKLNYKSEEEYPDLSKHNNHMAKALTPEIYKKLRDKETPSGFTLDDVIQTG
VDNPGHPFIMTVGCVAGDEESYVVFKDLFDPIIQDRHGGYKPTDKHKTDLNHENLKGGDD
LDPNYVISSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMT
EKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISM
EKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLA
HLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLM
VEMEKKLEKGQSIDDMIPAQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcggcaacacccacaacaagtacaagctgaactacaagtctgaggaggagtac
ccagacctcagcaagcacaacaaccacatggccaaggcgctgacccctgagatttacaag
aagctgcgagacaaggagactccatctggcttcactctggacgatgtcatccagacaggt
gtggacaacccaggtcaccccttcatcatgactgtgggctgtgtggctggtgacgaggag
tcctacgtggttttcaaggacctcttcgaccccatcatccaggaccggcacgggggctac
aaacccaccgacaagcataagaccgacctcaaccatgagaacctcaagggtggagatgac
ctggaccccaactatgtgatcagcagccgtgtccgcacgggccgcagcatcaagggctac
acgctgcccccgcactgctcccgcggtgagcgcagggcggtggagaaactctccgtggaa
gccctcaacagcctgacgggagagttcaaggggaagtactatcccctgaagagcatgaca
gagaaggagcagcaacagctcatcgacgaccacttcctgttcgacaagcccgtgtccccg
ctgctgctggcctcaggcatggcccgagactggcctgatgcccgtggcatctggcacaat
gacaacaagagcttcctggtgtgggtgaacgaggaggaccacctccgagtcatctccatg
gagaaggggggcaacatgaaggaagttttccgtcgattctgcgtggggctgcagaagatt
gaggagatcttcaagaaagccggccaccccttcatgtggaacgagcacctgggctacgtg
ctcacctgcccatctaacctgggcaccgggctgcgtggaggcgtgcatgtaaagctggca
cacctgagcaagcatcccaagttcgaggagatcctcactcgtctgcgcctgcagaagcgg
ggcacaggtggcgtggacacagctgccgtgggctcagtgttcgacgtgtccaacgccgat
cggctgggctcgtcggaggtggaacaggtgcagctggtggtggatggtgtgaagctcatg
gtggagatggagaagaagctggaaaagggccagtccatcgacgacatgatccccgcccag
aagtag

DBGET integrated database retrieval system