KEGG   Chlamydia trachomatis F/SW4: FSW4_2421Help
Entry
FSW4_2421         CDS       T02165                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
cfs  Chlamydia trachomatis F/SW4
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cfs03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
267700..268302
Genome map
AA seq 200 aa AA seqDB search
MLKYPDYISKLISFLKKLPGIGFKSAEKIAFELLEWDPSQIEAMALALQEFSTSHATCSN
CFCLKISQTSPCNFCSESRDSSSLCIVATPKDVFALEKSKIFKGHYFVLGNLLSPITGKH
LSLEKLAILKQRIEACSPKEMIIALDATLEGDATALFLKQEFSYLPIKISRLALGMPVGL
SFDFVDANTLARAFSGRNCF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaatatcctgattacatttcgaaactcatttcatttttaaaaaagcttccagga
attggctttaaatcagcagaaaaaatagcttttgaattattagaatgggatccatctcaa
attgaggctatggccctagcattacaagagttctctacttcgcatgcaacttgctcaaac
tgtttttgtttaaaaatctctcaaacttccccttgtaacttttgcagtgaatctcgagat
tcttcttccttatgtattgttgcaactcctaaggatgttttcgctctggagaaatctaag
atcttcaaaggacactatttcgttttaggaaacttactttctcccatcactggaaagcat
ttgtctttggaaaaattagctattcttaagcagcgaattgaagcttgttcccctaaagaa
atgatcatagctcttgacgcaactttggaaggagatgcaactgcattgtttttgaaacaa
gaattttcttaccttccaataaaaatctctagattagctcttgggatgcctgtcggtctc
tcctttgattttgttgatgctaatactttagctcgagctttttcaggaagaaattgcttt
taa

DBGET integrated database retrieval system