KEGG   Chlamydia trachomatis F/SW4: FSW4_2711Help
Entry
FSW4_2711         CDS       T02165                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cfs  Chlamydia trachomatis F/SW4
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cfs00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cfs00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(300612..302063)
Genome map
AA seq 483 aa AA seqDB search
MHLDQLLRNIPAKIYGKVESIPVRNLTRDSRCVGVGDIFIARQGQFCNGNDYSSQAVANG
AIAVLSSLYNPFLSVVQIIAEDPIALEASLAARFYNNPSRHLDVIGITGTNGKTTVSCLV
RELMERSGRRTGLIGTIEHILGENRIVDSFTTPDAILLQKYFAEMVKQNLSAAVMEVSSI
GMALGRVRETEFLAGVLTNITSDHLDFHGSLEEYIAAKKQFFASLPEKGIAVVNLDCEYA
PSFLNGSQARAVSYAIHQEADYRADRLKLYSSGSSYDIWYQGKVFLCETSLIGEHNVYNV
LASLAVVHQFLGGDFADLVRDVRFLSAPKGRLDPILLGPFPVYIDYAHTPDALDNVCRIL
LQLLPKDGRLIIVFGCGGDRDRVKRPLMAKVSEHYGFSFVTSDNPRTEDPDQIIADICKG
FSTDHYVVESDRKLAIEKAISMASDKDIVLVAGKGHEGYQIFKHQTIVFDDREVVCEALA
ALC
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcatttagaccaacttcttcggaatattccggctaaaatttatgggaaagtcgagtct
attcctgttagaaatttgactcgagattctcgttgtgttggagttggtgatattttcatc
gctcgacaagggcagttttgcaatggcaatgactattcttctcaggctgttgcgaatgga
gcgattgcagttctctcttctctatacaatccttttttatcggttgttcagattatcgca
gaagatcctatagcattggaagcctctttggcagcaaggttttataataatccttcaagg
catctggatgtaataggaattacaggaactaatgggaagacaacagtctcctgtttggtt
agagaacttatggagcgttcaggaagaagaactggtcttattggaaccatagagcacatt
ttaggtgagaataggattgttgatagctttaccactcctgatgcgattttattgcagaag
tattttgctgaaatggttaagcagaacttatctgcagccgttatggaagtatcttctata
gggatggctcttggtcgagttcgtgaaacagagttcttagctggagttttaactaacatt
acttcagatcatttagattttcatgggtctcttgaagaatatattgcagctaaaaagcag
tttttcgcttccttgccagagaaaggtatagctgttgtcaatttggattgtgagtatgcg
cccagctttttaaatggttctcaggcaagagcagtctcctatgcaatccatcaagaagct
gattatcgagcagatagattgaagctgtattcatcaggatcttcttatgacatttggtat
caggggaaagttttcctttgtgagacatccttgataggagaacataatgtatataatgtt
ttagcatctttagctgttgtccatcaatttttaggcggagactttgctgatttagtacgc
gatgttcgtttcttatcagctcctaaaggacgtttggatccgattttattggggccattc
cctgtttatattgattatgcccatactccagatgcattggacaatgtatgcagaatttta
ttacaactccttcctaaagatggtcggctaattattgtgtttgggtgtggtggagataga
gatcgtgttaagcgtcctcttatggccaaagtatctgagcattacggtttttcttttgtg
acttcagataatcctcggacagaagatccagaccagattattgctgatatatgtaaaggt
ttctcaactgatcattatgttgttgagagcgataggaagctagccatagagaaagcaata
tcaatggcttcagataaagatattgtactagttgcaggaaagggacatgaggggtatcag
atcttcaaacatcagacgattgtctttgatgatcgagaggttgtgtgtgaagccttggca
gccctttgttaa

DBGET integrated database retrieval system