KEGG   Chlamydia trachomatis F/SW4: FSW4_4061Help
Entry
FSW4_4061         CDS       T02165                                 

Gene name
sucB_1
Definition
lipoamide acyltransferase component (E2) of branched-chain alpha-keto acid dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cfs  Chlamydia trachomatis F/SW4
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FSW4_4061 (sucB_1)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FSW4_4061 (sucB_1)
  Amino acid metabolism
   00310 Lysine degradation
    FSW4_4061 (sucB_1)
Enzymes [BR:cfs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FSW4_4061 (sucB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(459154..460320)
Genome map
AA seq 388 aa AA seqDB search
MFEFRFPKIGETASGGIVVRWLKQVGDPVQKDEPLIEVSTDKIATELAPSQAGILEECLV
QEGEEVFPGDILARLRETAAANTPVKSPVENPVREENHSVDREQKWLSPAVLGFAQREGL
DLQELQKISGTGEGGRITRKDVERYLSDKREPRDPICSKEENRIPLSPLRRAIASSLRQS
SEEVPHASLVVDVDVTDLMNLISAERERFTAAHGVKLTITSFIIQCLAKSLEQFPLLNGS
LDGDTIVLKKAINVGVAVNLNKEGVVVPVIHNCQDRGLVSIAKVLADLSSRARSNKLDSS
ETKGGSVTVTNFGMTGALIGMPIIRYPEVAILGIGTIQKRVVVRDDDSLAIRKMMYVTLT
FDHRVLDGIYGGEFLTALKNRLESVTMS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagtttcgatttccaaaaataggggagaccgcatctggaggtattgttgtccga
tggttgaaacaggtcggagatcctgttcaaaaagatgagccattgattgaggtctcaaca
gataagatagctacagagttagctccttctcaagctggcattttggaggagtgcctggtt
caggaaggggaagaggttttccctggagatattctagcgcgtttgcgagaaactgctgca
gcgaatactcctgtaaaaagccctgtggagaatcctgttagagaagagaatcattctgta
gatagagagcagaaatggctctcgcccgcagtattaggatttgcccaaagagaagggtta
gatcttcaagaattacaaaagatctcggggacaggagaggggggacggattactcgtaag
gatgtagaacgctatctttccgacaagagagaacctagggatccgatctgttctaaagag
gaaaatagaattcctttgtcacctttacgtcgggctatcgcttcttctttacgacagtct
tcagaagaggtgccgcatgcttctctggttgttgatgtagatgttacagatttaatgaat
ctcatctctgcggagcgagagagatttactgctgctcatggagtgaaactcacgatcacc
agcttcattatacagtgcttagctaagtctttagagcagttcccactgcttaatggttct
ttagacggggatacgattgtcctcaagaaggctataaatgtaggagttgctgtaaatttg
aataaagaaggagtagttgttcctgttattcataattgtcaggataggggtcttgtaagt
attgctaaggttcttgcggatctttcttcaagggcgcgatctaataaattagattcctca
gaaacgaaagggggaagcgtcactgtaaccaactttggtatgactggagctcttattggc
atgccgataattcgttatccggaagtagcgattttggggatcggaacaattcaaaaacga
gtggttgtacgtgatgatgactcgttagccattaggaaaatgatgtatgtcactttaact
ttcgaccatcgagtattggatggaatttacggtggagagtttttaacagctttgaaaaat
cgcttagagtctgttacgatgagctag

DBGET integrated database retrieval system