KEGG   Chlamydia trachomatis F/SW4: FSW4_6631Help
Entry
FSW4_6631         CDS       T02165                                 

Gene name
recD_1
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cfs  Chlamydia trachomatis F/SW4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cfs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FSW4_6631 (recD_1)
Enzymes [BR:cfs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FSW4_6631 (recD_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
749306..750796
Genome map
AA seq 496 aa AA seqDB search
MNVNQHVQDIVPSLLTQHILLPFDIAFAQKHLSQEEFSQEAEAFLATASALLRCGYPYFS
ICDETIHPTLPGISNKQLFQWFQLLSSRIKEELFEVVNHKIYLRSLFLLREKVFHKLHRL
AGAVPRTPLIFEEIALLSEEQNQVLKTVLNSCFSLVCGGPGTGKTFLAVQMIRLILAQIP
SAQIVVASPTGKASAHLHSVLTSQGIVGDSVEVVTIHKFLKDMRRGRSPVDLLLVDEGSM
VTMNLLHGLIKTIRGESRGETIYADRMVIFGDANQLPPIGIGVGNPFHEVVSEFSKQACF
LSTSHRAKHKELQELASAVLRKELIPFQPLPSRQEAIRRLSFAFTQAAKEGVSLCALTPM
RQGLWGFLQLNRLLFNEMQEKHPRAPIPIIVTERYETWGLTNGDTGVLDPVTQQLRFMNG
EILHQADFPYYSYNYVMSVHKSQGSEYDRVIVILPKGSEVFDSAILYTAITRTKQHVEIW
ADREALEAIILKRGRY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtaaatcagcacgttcaagatattgtaccatctttgttaacacaacatattctt
ctcccttttgatatagcttttgctcaaaagcatttatcccaggaagagtttagtcaggaa
gcagaagctttcttagctacagcatccgcattattgcgttgtggttatccttatttttct
atttgtgatgagacgattcatcccacgctcccagggatttcaaataaacaactcttccaa
tggttccagctgttgtcatcccgcataaaagaagaactgtttgaagttgttaatcataag
atttatctacgctcattatttcttttacgggagaaggtgtttcataaattgcacagattg
gcgggagccgttccacgtacacctttaatttttgaagagattgctctgctctcagaagag
cagaaccaggtactgaaaactgtattaaattcttgcttctctctcgtttgtggaggacca
ggaacaggcaaaacatttttagctgttcagatgattcggttgatacttgcgcaaattcct
tcagcgcagatcgtggtagcttctccaacggggaaagcttccgctcatctgcatagcgta
ttaacgtctcagggaatcgttggagattctgtagaagtcgttacgattcataaattttta
aaagatatgcgtagaggacgctcccctgtagatctactattggttgatgaaggctcgatg
gtgaccatgaatctgttacatggactgattaaaaccatacgaggagaatcccgaggggaa
acgatctacgcagatagaatggtgatttttggggatgcgaatcagcttcctccgataggt
atcggagtagggaacccttttcatgaagttgtgtctgagttttccaaacaagcctgcttt
ttatctactagccaccgagctaaacataaggaattacaggaattagcgagcgctgttctg
cgcaaggagctgattccttttcaacctttgccttcccgacaagaagctattcggcgattg
tcttttgcttttacacaagcagcaaaagaaggggtgtcgttatgtgctttgactccgatg
cgccaaggactttggggttttttgcagttgaatcggttgttgtttaatgagatgcaggag
aaacatccacgggcacctattcctatcatcgtgacagaaagatatgaaacgtggggatta
acgaatggagatacaggagttttagatcctgtaacgcaacaattgcgtttcatgaatgga
gagattctgcatcaagcagattttccctattattcttacaactatgtcatgtctgtgcac
aaaagtcagggtagtgaatatgatcgtgtgattgtcattcttcctaaaggcagtgaagtc
tttgattcggcaattctctatactgcaattacaagaaccaaacaacacgttgagatttgg
gctgatcgagaagctttagaggcgatcattttgaaaagagggcgttattaa

DBGET integrated database retrieval system