KEGG   Chlamydia trachomatis F/SW4: FSW4_8821Help
Entry
FSW4_8821         CDS       T02165                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cfs  Chlamydia trachomatis F/SW4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cfs00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1021597..1023813
Genome map
AA seq 738 aa AA seqDB search
MDPFFLNTQHVELLVSGKQSSPQDLLGIVSESLNQDRIVLFRPGAETVFVELRGKIQQAE
SHHSGIFSLPVMKGISPQDYRVYHQNGLLAHDPYAFPLLWGEIDSFLFHEGTHQRIYERM
GAIPCEIDGVPGVRFIVWAPHAQRVSVIGDFNGWHGLVNPLHKVSDQGVWELFVPGLTAG
ACYKWEMVTESGQVLIKSDPYGKFFGPPPRSVSVVIDDSYEWNDSEWLEERIKKTEGPMN
IYEVHVGSWRWQEGQPLNYRELADQLALYCKQMHYTHVELLPVTEHPLNESWGYQTTGYY
APTSRYGSFEDLQYFIDTMHQHGIGVILDWVPGHFPIDSFAMSGFDGTPLYEYTRNPSPL
HPHWHTYTFDYAKPEVCNFLLGSALFWIDKMHVDGIRVDAVSSMLYLDYGRYAGEWVPNR
YGGRENLDAIRFLQQFNTVIHEKYPGVLTFAEESTTFPKITVSVEEGGLGFDYKWNMGWM
HDTLHYFEKDFPYRPYHQSDLTFPQWYAFSERFLLPFSHDEVVHGKRSLIGKMPGDAWRQ
FAQLRLLLGYQICQPGKKLLFMGGEFGQGREWSPGRELDWELLDISYHQGVHLCSQELNA
LYVQSPQLWQADHLPSSFRWVDFSDVRNGVVAYLRFADADAKKALLCVHHFGVGYFPHYL
LPILPLESCDLLMNTDDTRFGGSGKGFREPEILTPEIARQEREAAGLIEADDESGPDCWG
LDIELPPSATLIFSVTLQ
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
gtggatccttttttcttaaatactcaacacgtggaacttctcgtttctggtaaacagagc
agtccacaagatcttttgggaattgtttctgaaagtttgaatcaagatcggatagttctt
ttccgccctggggcagagaccgtttttgttgagttgcggggtaagattcaacaggcagag
tcgcaccattcagggattttttctcttcctgtaatgaaaggaatttctccccaagattat
cgagtctatcatcaaaatggtttattggctcatgatccttatgccttccctttactttgg
ggggaaatcgattcttttttattccatgaagggactcatcagcgtatctatgaacgcatg
ggtgctatcccttgtgaaattgatggagtacctggagtaagatttattgtttgggcccct
catgctcaacgtgtttctgttattggagattttaatgggtggcatgggctcgttaatcct
cttcataaggtttcagatcaaggagtttgggagctgtttgttcctggccttacagcagga
gcttgttacaaatgggaaatggtcacagaatctgggcaggttctcattaaatcggatcct
tatgggaagttttttggtcctcctcctcggagcgtttccgttgttatcgatgattcttat
gaatggaacgatagcgagtggttagaagagcgcattaaaaagactgaaggccctatgaat
atctatgaagttcatgtagggtcttggcgatggcaggaaggacaacctttgaattataga
gagctagcagatcagctagctctctattgcaagcagatgcattatacgcatgtagagttg
cttcccgtaaccgagcatcctttgaatgaatcttggggatatcaaacaacgggatattat
gctcctacaagtcgttatggctcttttgaagatttacagtattttatagataccatgcat
cagcatggtatcggggtgattttagattgggttccaggacacttccctatagattcattt
gcaatgagtggttttgatggcactcctctgtatgaatatacacggaatccgagtccgttg
catcctcactggcacacctacacttttgattatgctaaaccggaagtgtgcaattttctt
ttaggaagtgcgctcttttggatcgataaaatgcatgtagatggtattcgtgtggatgct
gtctcatctatgctctatttagattatggaagatatgctggagaatgggttccaaatcgt
tatggtggaagagagaaccttgatgcgattcggtttcttcagcaattcaacactgtgatt
catgagaaatatccaggtgttttgactttcgcagaggagtcgacaaccttccctaagatt
actgtatctgtcgaagaagggggattagggtttgattacaaatggaatatgggatggatg
catgatacactgcattatttcgagaaggatttcccatatcgtccttatcaccagagcgat
ctcactttcccacaatggtatgcttttagtgagaggtttttactgcctttttcccatgat
gaggttgttcatgggaaacgcagtttaatcggtaagatgcctggagatgcttggagacag
tttgctcagttgcgtttattattaggttatcagatctgtcaaccaggaaagaaattgctt
ttcatggggggagagttcggtcaggggagagagtggtcccccggtcgtgagctagactgg
gaattattagatatttcttatcatcaaggtgtgcatttgtgttcgcaagagctaaatgct
ttatatgtgcagagcccgcaactgtggcaagcggaccatcttccctcctctttccgttgg
gtcgattttagtgatgtgcgcaatggcgttgttgcttatctccgctttgcagacgcggat
gctaagaaagctttgctttgcgtgcatcattttggggtaggatactttcctcattactta
cttcccatactccccctagaatcttgtgatttgctgatgaatacagatgacacaagattc
gggggatcggggaaaggttttcgagagcctgaaatccttacacctgaaatcgcgagacaa
gagagagaggctgcaggactgatcgaagcggatgatgaaagtggtcccgactgctggggc
ttagatattgagctgcctccttcagctactctgattttttctgtaacgctacagtaa

DBGET integrated database retrieval system