KEGG   Collimonas fungivorans: CFU_0020Help
Entry
CFU_0020          CDS       T01583                                 

Gene name
bga
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cfu  Collimonas fungivorans
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cfu00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(29338..32331)
Genome map
AA seq 997 aa AA seqDB search
MKRRDFLGYAVVTPLLAACGVGSEDNAPTNSPSAKALAAAGNTANAVFASGGNHTLSWNS
SGNWFMDGSAFQFFGGEIHPARVPSQYWDHRIKMIKALGCNTISIYLMWNFHELSDGSFD
FSSPDKNMGHFIDLCAQNGMWVLLRPGPYVCAEWDFGGLPPRMLADPQFRDSAGKLQIRG
NFASYMAAVNSWNTALYNNVVKGRTLAAGGPIMLVAVENEYTSWSPDDGTYPNAIAQQWT
TLGYAEKFCVCDGYASGFKNNHITLPANTAYGMTADGASAGNYATAAANYGVGAFGAECY
PGWICHWGDASQTLHVGDFVSQVTALTTSKCSFVLYVAHGGTNFGFTSGSNGVSDSSCQG
TITSYDYGAPVSESGGANPNFSPIQAAYVANASYSVPFAATPAGIPHISDGDIAAVSSSQ
LTYCGLLPGLNLTIQNRLPQTMEAMALALNKNQPASAGVYPSGVAVYQTTLPASGGNFTL
TFDRAPDYALVFVNGVRASSQVLSTASNGALSPTTSLTISNAAPNATLQIVCMPFGRVNF
GAGGMNAEGKGLSLNVYANGTALINWSMALAPLSAAQVAALTFSATAPAGSQPFFAKATV
NIATPQDMYIDMSAWGSGYVFVNGYNLGRYWTAAGPQKRLYCPGVWLTSGSNTIVVFEFI
QGSAGSLSFYGASGMPQNITGPASTAAVPPPAANTYFLQNVNSGLYLDVMPAVAGSVYTY
PGVQPLSAAATQGWTVSTDSFGNLKIVNASTGAALDVANNSTAPGSSVILYAANGGANQS
WKAAGVGTGIYTLAGKQSQLLLDINGASKAPTLISSSSATANVITNPADNPSQQWPFSQQ
WRFLPAIVNNGVYTITSAISSLMLGVYQGGTAAGTRLGIAAATGGQEQQWRLTISSGNWQ
LTNIKSGLVIDVTGQKTDNGTALEIWQGNGGANQQFALVPRPDGVSYGIKGVQSGRVIDD
NNSGTSPTSYGTTDVSAITLWDDNGGGNQSWKFAKVG
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaagagacttccttggttatgcagtagtcacgccgctattggcggcttgcggt
gtcggcagcgaggacaatgcgccaaccaattcaccgagcgcaaaggcccttgccgctgcc
ggcaataccgccaacgccgtgttcgccagcggcggcaaccacactctctcctggaacagc
agcggcaactggttcatggacggttcggcgttccagttcttcggcggtgagatccatccg
gcgcgtgtcccttcgcaatactgggaccaccgcatcaagatgatcaaggcgctgggctgc
aacaccatctcgatctatctcatgtggaatttccacgaactgtccgacggctcgttcgac
ttcagctcgcccgacaagaacatgggccacttcatcgacctgtgcgcgcagaatggcatg
tgggtgctgctgcgccccggcccttacgtctgcgccgaatgggatttcggtggcctgccg
ccgcgcatgctggccgatccgcagttcagggacagcgccggcaagctgcagatccgcggc
aacttcgccagttacatggcggccgtcaacagctggaataccgcgctctacaacaatgtc
gtgaaggggcggaccttggcggcaggcggtccgatcatgctggtggccgtggagaacgag
tacacctcctggtcacccgatgacggcacttatccgaacgcaatcgcgcagcagtggacg
acgctcggctatgcggaaaaattttgcgtgtgcgacggttacgccagcggcttcaagaac
aaccatatcaccctgccagccaataccgcctacggcatgaccgcggatggcgcgtcggcc
ggcaattatgcgaccgccgccgccaattacggcgtaggcgcgttcggcgcggagtgttat
ccgggctggatttgccactggggggacgccagccagaccctgcatgtcggggatttcgtg
agccaggtcaccgcgctgaccacgtcgaagtgttcgtttgtgctgtatgtggcgcatggc
ggcaccaatttcgggtttacctccggttccaacggcgtcagcgattcgagctgccagggc
accatcacgtcctacgactacggcgcgccggtatccgaatccggcggcgccaatccgaac
ttttcgccgatccaggctgcctatgtcgccaacgcgtcgtacagcgtgccgtttgccgcc
acgccggccggcatcccgcatatcagcgacggcgatatcgcggcggtgtcgagcagccag
ctgacttattgcggcttgctgcccggcctcaacctgactatccagaaccggctgccgcaa
accatggaagcgatggcgctggcgctgaacaagaaccagccggccagcgcgggggtgtat
ccttccggcgtggcggtttaccagaccacgctgccggcctccggcggcaacttcaccctt
acctttgaccgcgctcctgactatgccctggtgttcgtcaacggcgtgcgcgcttccagc
caggtgctcagcacggcatccaacggcgcgttgtctccgaccacatccctgacgatcagc
aatgccgcgccgaacgccacgctgcagatcgtctgcatgccgttcgggcgggtcaacttc
ggcgccggcggcatgaatgccgagggcaagggattgtcgctgaacgtctacgccaacggc
actgcgctgatcaactggagcatggcgctcgcgcccctgtcggcggcgcaggtcgcggcg
ctcactttcagcgccacggcgcctgccggcagccagccgttctttgccaaagccacggtc
aacatcgcgacgccgcaagacatgtatatcgacatgtccgcctggggcagcggttatgtc
ttcgtgaacggctacaacctgggccgctactggaccgccgccggtccgcagaagaggttg
tactgtcccggcgtgtggctgaccagcggcagcaatacgatcgtggtgttcgagttcatc
cagggcagcgcaggcagcctgagtttctatggtgcgagcggcatgccgcagaatatcacc
ggccccgccagcacggcagcggtgccgccgcctgccgccaacacttatttcctgcagaac
gtcaacagcggcctgtacctggacgtgatgccggcggtggcgggatcggtctacacctat
cccggcgtgcagccgctaagcgccgccgcgacgcagggctggacagtaagcaccgacagc
ttcggcaacctgaagatcgtcaacgccagcaccggcgcggcgctggacgtcgccaacaac
agcacggcgccgggctcctcggtgatcctgtatgcggccaacggcggcgccaaccagagc
tggaaagcggccggcgtcggcaccggcatctacaccctggccggcaagcaaagccagctg
ctgctggacatcaatggcgcatccaaggcgccgacgttgatctcgtccagcagtgcaacc
gccaacgtcatcaccaatccggccgacaatcccagccagcaatggccgttcagccagcaa
tggcgcttcctgccggccatcgtcaacaacggcgtctacaccatcaccagcgccatcagc
agcctgatgctgggcgtctaccagggcggcacggccgccggcacccgcctcggcatcgct
gctgctaccggcggccaggagcagcaatggcggctgaccatttccagcggcaactggcag
ctgaccaacatcaagagcggcctggtgatagacgtgaccggccagaagaccgacaacggc
accgcgctggagatctggcaaggcaacggcggcgccaaccagcagttcgcgctggtgccg
cggccggatggcgtgagctatgggatcaagggtgtgcagagcgggcgcgtcatcgacgac
aacaattcgggtacgtcgcctaccagttatggcacgaccgatgtgtctgcgattacgctg
tgggatgacaatggtggaggcaaccagagctggaagttcgccaaggtggggtag

DBGET integrated database retrieval system