KEGG   Collimonas fungivorans: CFU_0025Help
Entry
CFU_0025          CDS       T01583                                 

Gene name
jamB
Definition
(GenBank) Stearoyl-CoA 9-desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
cfu  Collimonas fungivorans
Pathway
cfu01040  Biosynthesis of unsaturated fatty acids
cfu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CFU_0025 (jamB)
Enzymes [BR:cfu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CFU_0025 (jamB)
Lipid biosynthesis proteins [BR:cfu01004]
 Desaturase
  First
   CFU_0025 (jamB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase Kelch_2
Motif
Other DBs
NCBI-ProteinID: AEK59864
UniProt: G0A7V3
Position
complement(40687..40971)
Genome map
AA seq 94 aa AA seqDB search
MTWAVNSIGHTFGKRPNQTRDTSGNIGWLALVSAGGGWHNNHHANPALAHNDFHFWQIDT
TAWVIRLLGLLGLAWDIRQRQSADPLDQKLFNND
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
gtgacctgggcggtcaattcgatcggccataccttcggcaagcggcccaaccagacgcgc
gacaccagcggcaacatcggctggctggcgctggtgtcggccggcggcggctggcacaac
aaccatcacgccaacccggcgctggcgcacaacgatttccatttctggcagatcgacacc
accgcctgggtgatccggctgttaggactgctcggcctggcctgggatatccgccaacgc
cagagcgccgatccgctggaccagaaacttttcaataacgattaa

DBGET integrated database retrieval system