KEGG   Collimonas fungivorans: CFU_0025Help
Entry
CFU_0025          CDS       T01583                                 

Gene name
jamB
Definition
(RefSeq) stearoyl-CoA 9-desaturase (EC:1.14.19.1)
  KO
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cfu  Collimonas fungivorans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CFU_0025 (jamB)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CFU_0025 (jamB)
Enzymes [BR:cfu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CFU_0025 (jamB)
Lipid biosynthesis proteins [BR:cfu01004]
 Desaturase
  First
   CFU_0025 (jamB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(40687..40971)
Genome map
AA seq 94 aa AA seqDB search
MTWAVNSIGHTFGKRPNQTRDTSGNIGWLALVSAGGGWHNNHHANPALAHNDFHFWQIDT
TAWVIRLLGLLGLAWDIRQRQSADPLDQKLFNND
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
gtgacctgggcggtcaattcgatcggccataccttcggcaagcggcccaaccagacgcgc
gacaccagcggcaacatcggctggctggcgctggtgtcggccggcggcggctggcacaac
aaccatcacgccaacccggcgctggcgcacaacgatttccatttctggcagatcgacacc
accgcctgggtgatccggctgttaggactgctcggcctggcctgggatatccgccaacgc
cagagcgccgatccgctggaccagaaacttttcaataacgattaa

DBGET integrated database retrieval system