KEGG   Collimonas fungivorans: CFU_0026Help
Entry
CFU_0026          CDS       T01583                                 

Definition
(GenBank) Delta-9 fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
cfu  Collimonas fungivorans
Pathway
cfu01040  Biosynthesis of unsaturated fatty acids
cfu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CFU_0026
Enzymes [BR:cfu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CFU_0026
Lipid biosynthesis proteins [BR:cfu01004]
 Desaturase
  First
   CFU_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AEK59865
UniProt: G0A7V4
Position
complement(40694..41635)
Genome map
AA seq 313 aa AA seqDB search
MTDTKNPAAAAPGEKVQALRDGDSKARRLAYLTVLTPAVGFVAALWYSIQFGFKQQDMIL
LGAMYFLTSFGVEGGLHRFFSHRAFKAGPVVTAVIGILGCMAAQGPILFWAATHRMHHVF
TDQDGDPHSPRVLSPGLRGRIKALWHGHVGWLFTVKRSNWSTYVPDLFGSKLVLFVNQHY
LIWVLLGLALPTAIGAALSGIEGTIGGLLWGGAGPDIPARPSDLGGQFDRPYLRQAAQPD
ARHQRQHRLAGAGVGRRRLAQQPSRQPGAGAQRFPFLADRHHRLGDPAVRTARPGLGYPP
TPERRSAGPETFQ
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgataccaaaaatcccgctgccgcagcgcctggcgagaaagtgcaagcgctcagg
gacggcgatagcaaggcgcgcaggctggcttacctgaccgtgctgacgcccgccgtcggt
ttcgtcgccgcgctgtggtattcgatccagttcggcttcaagcagcaagacatgatcctg
ctcggcgccatgtatttcctgacgtcgttcggcgtcgagggcggtttgcaccgcttcttt
tcgcaccgcgcgttcaaggccggaccggtcgtgaccgccgttatcggcatcctcggctgc
atggcggcgcaagggcccatcctgttctgggcggcgacgcaccgcatgcaccacgtcttc
accgaccaggacggcgatccgcattcgccgcgggtgctgtcgcctggcctgcgcggccgc
atcaaggctttgtggcacggccacgtcggctggctgtttaccgtcaagcgcagcaactgg
agtacctacgtaccggacctgttcggcagcaagctggtgctgttcgtcaaccagcactac
ctgatctgggtcttgctcggcctggcgctgccgaccgcaatcggcgccgccctgagcggt
atcgaaggcacgatcggcggcctgctgtgggggggggctggcccggatattcctgctcga
ccaagtgacctgggcggtcaattcgatcggccataccttcggcaagcggcccaaccagac
gcgcgacaccagcggcaacatcggctggctggcgctggtgtcggccggcggcggctggca
caacaaccatcacgccaacccggcgctggcgcacaacgatttccatttctggcagatcga
caccaccgcctgggtgatccggctgttaggactgctcggcctggcctgggatatccgcca
acgccagagcgccgatccgctggaccagaaacttttcaataa

DBGET integrated database retrieval system