KEGG   Collimonas fungivorans: CFU_0144Help
Entry
CFU_0144          CDS       T01583                                 

Definition
putative lipoprotein transmembrane (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cfu  Collimonas fungivorans
Brite
Enzymes [BR:cfu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CFU_0144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(177615..178991)
Genome map
AA seq 458 aa AA seqDB search
MDVSSFCHTTLLGLPPIQFNAAQRSARPPRLVNIPMKPAVIAAVIVFMSGVAVLALNGCG
QQHADAEAAKPAAPAYVGAAYAPTLKKQPSVAAMTALGRTMFSDPSLSASGKMSCATCHS
PDHAFGPPNNLAVQLGGKEMKTLGTRAVPSLRYIQNVPAFTEHFFDDDGDDSIDAGPTGG
HNWDGRAPSTHDQARIPLLSAHEMGNASAAEVVEKLKKASYVAQFRATFGEDIFDNQEQA
FKWALMALEVFQESPTEFYPYNSKYDAFLRQQTQLSKQELNGLRLFNDASKGNCASCHIS
EITASGAFPQFTDYGLIAIGVPRNKNIPANADPKYFDMGLCGPDRTDLKDKTEYCGMFKT
PSLRNVATRQVFFHNGAFTSLEQVMKFYVQRDTQPQKWYPRDKDGKVRKFDDLPEAYHGN
VNVEAPFDRKPGDRPALTDGEIKDVIAFLKTLNDGYRP
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtggatgtgtcatcgttctgtcacacaacgctgctaggcttgcctcccattcaattcaac
gcggcgcagcgctccgctcgtcctccgaggcttgtcaacattcctatgaaaccagcggtc
attgcggcagtcattgtattcatgagcggcgtcgccgtgcttgccctgaacggctgcggc
caacagcatgcggacgctgaagccgccaagcctgctgccccggcctacgtcggcgccgcc
tatgcgccgacgctgaaaaagcagccctcggtggccgccatgaccgcgctcggccgcacc
atgttctccgatccctcgctgtcggcctcgggcaagatgtcttgcgctacctgccacagt
cccgaccatgcattcggtccgcccaacaacctggcggtgcagctgggcggcaaggaaatg
aaaacgctgggcacgcgcgccgtgccttcgctgcgctatatacagaacgtgccggcattc
accgagcatttcttcgacgacgacggcgacgacagcatcgacgccggccccacaggcggc
cacaactgggacggccgcgcgccatcgacccacgaccaggcgcggattccgctgttgtcg
gcacacgaaatgggcaatgcgagtgcggctgaagtggtggagaaactgaagaaggccagc
tacgtggcgcaattccgcgccaccttcggcgaagatattttcgacaaccaggaacaggct
ttcaagtgggcgttgatggcgctggaagtattccaggagagcccgaccgagttttatccg
tacaacagcaagtacgacgccttcctgcgccagcaaacccagctcagcaaacaggagttg
aacggcttgcgcctgttcaacgatgcgtccaaaggcaactgcgcctcatgccatatcagt
gaaatcaccgccagcggcgcgtttccgcaatttaccgactacggcctgattgccatcggc
gtgccgcgcaacaagaatattccggccaacgccgatccgaaatatttcgacatgggcttg
tgcggcccggaccgcaccgacctcaaggacaagaccgaatattgcggcatgttcaagaca
ccgtccttgcgcaacgtcgccacgcgccaggtgtttttccacaacggcgctttcaccagc
ctggagcaggtgatgaagttctacgtgcagcgcgatacccagccgcagaaatggtatccg
cgcgataaagatggcaaggtgcgcaaattcgacgacctgcccgaggcctatcatggcaac
gtcaatgtcgaagcgccgttcgaccgcaagccaggcgaccggccggcgctcacggatggc
gagatcaaggatgtcatcgccttcctgaaaaccctgaacgacggttaccgcccataa

  All links  
No link information was found.   
DBGET integrated database retrieval system