KEGG   Collimonas fungivorans: CFU_0513Help
Entry
CFU_0513          CDS       T01583                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cfu  Collimonas fungivorans
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cfu00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cfu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
617053..618375
Genome map
AA seq 440 aa AA seqDB search
MTGRAAALPDTTNTTERTPLREVTMDKLLIQGGNRLSGEITISGAKNAALPILCAGLLTA
DQLQLSNVPNLHDVSTILKLLRQMGLKATQDGHFVTLQGDAITNLEAPYEMVKTMRASIL
VLGPLLARFGEARVSLPGGCGIGSRPVDQHIKGLQAMGAEISIEAGYIHAKAKKLKGTRV
VTDMITVTGTENLLMAATLADGETVLENAAREPEVTDLANLLVAMGAKIDGIGTDRLTIQ
GVDKLHGAEHAVIADRIETGTFLCAVAATGGDVMLKNTRSHILDAVLDKLREAGVILTSG
DDWIRVQMAARPKAVSFRTTEYPGFPTDMQAQFMSMNSIAEGTSHVTETIFENRFMHVQE
MNRLGAAIDVQGNTAIIKGVDKLVGAPVMATDLRASASLVISGLVAQGQTLIERVYHLDR
GYDQMECKLSAVGANIERIK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccgggcggctgccctgccagatacaacgaacaccactgaacgaacaccactg
cgagaagtcaccatggataaattattgatacaaggcggtaaccgcctttccggcgagatc
accatttccggcgcaaaaaatgcggcgctgcctatcctgtgcgccggtttgcttaccgcc
gaccagctgcagctgagcaacgtgcccaacctgcacgatgtgtcgaccatcctcaagctg
ctgcgccagatgggattgaaagcgacccaggatggccatttcgtgaccttgcaaggcgac
gccatcaccaacctcgaagcgccttatgaaatggtgaaaaccatgcgcgcatcgatcctg
gtgctgggcccgctgctggcgcgtttcggcgaagcacgggtatcgctgccgggcggctgc
ggcatcggctcgcgtccggttgaccagcacatcaagggcctgcaggcgatgggcgccgag
atttcgatcgaagccggctacattcatgccaaggccaagaagctcaagggcacacgcgtg
gtgaccgacatgatcaccgtcaccggtactgaaaacctgctgatggccgcaacccttgcc
gacggcgaaacggtcctggaaaacgctgcgcgcgaaccggaagtcaccgacctcgccaac
ctgctggtggcgatgggcgcgaagatcgacggcatcggcaccgaccgcctgacgatccag
ggcgtcgacaagctgcacggcgccgagcatgcagtgatcgccgaccgtatcgagaccggc
accttcctgtgcgcggtagcggctaccggcggcgacgtcatgctgaaaaacacccgcagc
catatcctcgacgccgtgctggacaagctgcgcgaagcgggcgtgatcctgacttccggc
gacgactggatccgcgtgcagatggcagcgcggccgaaggcggtcagtttccgcaccacc
gaatacccgggtttcccgaccgacatgcaagcgcagttcatgtccatgaacagcattgcc
gagggcaccagccatgtcaccgaaacgatctttgaaaaccgtttcatgcacgtgcaggaa
atgaaccgcctcggcgccgccatcgatgtgcagggcaataccgccatcatcaagggcgtc
gacaagctggtcggcgcgccggtgatggcgaccgacctgcgcgcttccgcttcgctggtg
atttccggcctggtggcgcaaggccagaccctgatcgaacgcgtctaccacctggaccgc
ggctatgaccagatggagtgcaagctgtcggcagtcggcgccaacatcgaaagaatcaaa
tga

DBGET integrated database retrieval system