KEGG   Collimonas fungivorans: CFU_0708Help
Entry
CFU_0708          CDS       T01583                                 

Gene name
paaF
Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cfu  Collimonas fungivorans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CFU_0708 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CFU_0708 (paaF)
   00650 Butanoate metabolism
    CFU_0708 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    CFU_0708 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFU_0708 (paaF)
   00310 Lysine degradation
    CFU_0708 (paaF)
   00360 Phenylalanine metabolism
    CFU_0708 (paaF)
   00380 Tryptophan metabolism
    CFU_0708 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFU_0708 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CFU_0708 (paaF)
   00281 Geraniol degradation
    CFU_0708 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFU_0708 (paaF)
   00627 Aminobenzoate degradation
    CFU_0708 (paaF)
   00930 Caprolactam degradation
    CFU_0708 (paaF)
Enzymes [BR:cfu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CFU_0708 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
827924..828700
Genome map
AA seq 258 aa AA seqDB search
MTYENILVETQGKVGLIHLNRPKALNALNDQLMSELGEALLKFDADPEIGCIVLTGSDKA
FAAGADIGGMAELSYMDVFKGDYITRNWEKIRSVRKPVIAAVAGFALGGGCELAMMCDFI
IAADNAKFGQPEIKLGIIPGAGGTQRLPRAISKSKAMDMCLTARMMDAAEAERAGLVSRV
VPLERLLQEALEAAIVISSMSLPAVMMIKESVNRAYETTLAEGINYERRLFHSTFATEDQ
KEGMQAFLGKRLPVFKNL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacatacgaaaacattctggttgaaacacaaggaaaagtcggcctcatccacctgaat
cgccccaaggccctgaacgccctgaacgaccagctgatgagcgagctgggcgaggctttg
ctgaagttcgacgctgatcccgagatcggctgcatcgtgctgaccggcagcgacaaggcg
tttgccgccggcgccgacatcggcggcatggccgagctgagttacatggatgtgttcaag
ggcgactacatcactcgtaactgggagaagatccgcagcgtgcgcaagccggtgattgcc
gccgtagcggggtttgccctgggcggcggctgcgagctggccatgatgtgcgacttcatc
atcgctgctgacaacgccaagttcggccagccggaaatcaagctgggcatcattcccggc
gccggcggcacccagcgcttgccgcgcgccatatcgaagtccaaggcgatggacatgtgc
ctgaccgcgcgcatgatggacgccgccgaagcagagcgcgccggcctggtgtcgcgcgtg
gtgccgctggaaaggctgctgcaggaagcgctggaagcggcgatcgtgatttcctcgatg
tcgttgccggcagtcatgatgatcaaggaatcggtcaaccgcgcctatgaaaccaccctg
gcggagggcatcaactatgagcgccgcctgttccacagcaccttcgctacagaggaccaa
aaggagggcatgcaggccttcctgggaaaacgtttacccgtttttaaaaatctttaa

DBGET integrated database retrieval system