KEGG   Collimonas fungivorans: CFU_0814Help
Entry
CFU_0814          CDS       T01583                                 

Definition
phosphomannomutase/phosphoglucomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cfu  Collimonas fungivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFU_0814
   00030 Pentose phosphate pathway
    CFU_0814
   00051 Fructose and mannose metabolism
    CFU_0814
   00052 Galactose metabolism
    CFU_0814
   00500 Starch and sucrose metabolism
    CFU_0814
   00520 Amino sugar and nucleotide sugar metabolism
    CFU_0814
  Nucleotide metabolism
   00230 Purine metabolism
    CFU_0814
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CFU_0814
Enzymes [BR:cfu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CFU_0814
    5.4.2.8  phosphomannomutase
     CFU_0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
957295..958683
Genome map
AA seq 462 aa AA seqDB search
MLPLSKSIFKAYDIRGVVGKTLDIGIARQIGQAFGTAARAKGEKTVIIGRDGRLSGPELA
TALAAGLRDAGVDVVDLGVVVTPMVYFATHVLSAQSGIMVTGSHNPPDYNGFKMVLAGEA
IYGETIQQLYQAIDDGSVEATISVPSGSYRQHDIRQAYLQRIVSDTKLARPMKIVVDCGN
GVAGAFAGELYRALGCEVQELFCEVDGTFPNHHPDPAHPENLQDVIRALQNSDAEIGLAF
DGDGDRLGVVTKDGQIIYPDRQLMLFAADVLTRHPGREILYDVKCTRHLAPWITAHGGKP
LMWKTGHSLVKAKMRETGAPLGGEMSGHVFFKDRWYGFDDGLYAGVRLLELLSRESDPSA
VLNALPQSSSTPELQLKLEEGENFSLIEKLQGEAKFPGADDIIKIDGLRVEYPDGFGLAR
SSNTTPVIVMRFEAESPSALLRIQSEFKRVILAAKPDAALSF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcttccactttcaaaatccatattcaaggcttacgatatccgaggcgtcgtcggtaaa
actctggacatcggcatcgcgcgccagatcggccaggccttcggcaccgccgcccgggcc
aaaggtgaaaagaccgtgattatcggccgcgacggccgtttatccggacctgaacttgcc
accgccctggctgccggcttgcgcgatgccggtgtggatgtggtcgacctgggagtagtg
gtgacgccgatggtgtatttcgcgacccatgtactgagcgcacagtccggcatcatggtc
accggcagccataatccgcctgattacaacggcttcaagatggtgctggcgggcgaggcg
atatatggcgagaccatccagcagctgtaccaggccatcgacgacggcagcgtcgaggca
accatatctgtgccaagcggcagctaccgccagcacgacatcaggcaagcttatctgcag
cgcatcgtcagcgacaccaagctggcgcggccgatgaagatcgtggtcgattgcggcaac
ggcgtcgctggcgcctttgccggcgagctgtatcgcgcgctcggctgtgaggtgcaggag
cttttctgcgaagtggacggcactttccccaaccaccatcccgatccggcccatccggag
aacctgcaggacgtgatccgcgccctgcagaattcggacgccgaaatcggcctggccttc
gacggcgatggcgaccgcctcggcgtggtcaccaaggatggccagatcatctatccggac
cggcagctgatgctgtttgccgcggacgtgctgacacgccatccgggccgcgagatcctg
tacgacgtcaaatgcacgcgccacctggcgccgtggattaccgcgcatggcggcaagccg
ctgatgtggaagaccggccattcgctggtcaaggccaagatgcgtgaaaccggggcgccg
ctgggtggtgagatgagcggccatgtgttcttcaaggaccgctggtacggtttcgacgac
ggcttgtacgctggcgtgcgcttgctggaactgctgagccgcgaaagcgatccgtcggcg
gtgttgaacgcgttgccgcaatcgtccagcacgcccgagctgcagctgaaactggaagaa
ggggagaacttcagcctgatcgaaaaactgcaaggcgaggcgaaattccccggcgccgac
gacatcatcaagatcgacggcctgcgtgtcgaatatccggacggcttcggcctggcgcgc
tcatccaataccaccccggtcattgtgatgcgcttcgaagccgagtcgccatcggcgctg
ctccgtatccagtctgaattcaagcgtgtgatcctggctgcgaagccagacgcagcgtta
tccttctaa

DBGET integrated database retrieval system