KEGG   Collimonas fungivorans: CFU_0838Help
Entry
CFU_0838          CDS       T01583                                 

Gene name
pcm
Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cfu  Collimonas fungivorans
Brite
Enzymes [BR:cfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CFU_0838 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD Methyltransf_31 Methyltransf_12 Methyltransf_23 Methyltransf_18 MTS Methyltransf_11 Ubie_methyltran PrmA Cons_hypoth95 Methyltransf_24 Methyltransf_32 MetW Met_10 DUF938 GidB CMAS Methyltransf_15 Spermine_synth
Motif
Other DBs
NCBI-ProteinID: AEK60672
UniProt: G0AI89
Position
complement(991915..992580)
Genome map
AA seq 221 aa AA seqDB search
MNIEQARFNMIEQQIRPWNVLELDVLELLTVVRREEFVPAAYKSLAFSDTEIPLPGPNGE
SMLAPKVEARLLQQAAVKKHEQVLEIGAGSGYMAALLCYKARHVTTVEIDPELKALAEKN
LAAYGITNVEVVLGNGAQGWDQGASKTYDVIVISGSLSTLPDAFLKQLNVGGRIVAILGE
APVMSAQIITRTSDSNYSTVHLFETNVKPLREAAVHSQFKF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaacaagcccgcttcaacatgatcgaacagcaaattcgcccttggaacgtg
ctggaactggacgtgctggaattgctgacggtagtacggcgcgaggaattcgtccctgcc
gcttacaagagcctggcgttttccgataccgaaatcccgctgcctggcccgaacggcgaa
agcatgctggcgcccaaggtcgaagcgcgcctgctgcagcaagctgccgtgaaaaaacat
gagcaggtgctggaaatcggcgccggttccggctacatggcggctttgttgtgctacaag
gcaaggcatgtgacaacggtagaaatcgatcccgagctgaaagcgctggccgaaaagaat
ctggcggcctacggcatcaccaatgtcgaggtagtgcttggcaacggcgcccagggctgg
gaccaaggcgcaagcaagacctacgacgtgatcgtgatttccggctcgctgtcgacgctg
cctgacgccttcctcaagcagctcaatgtcggcggccggattgtcgccatcctgggtgaa
gcgccggtgatgtcggcgcagatcattacccgtacttcggacagcaactacagcacggtc
cacctgtttgaaaccaacgtcaaaccgctgcgcgaagctgccgttcactcccaattcaaa
ttctaa

DBGET integrated database retrieval system