KEGG   Collimonas fungivorans: CFU_0927Help
Entry
CFU_0927          CDS       T01583                                 

Gene name
cheB
Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cfu  Collimonas fungivorans
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cfu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cfu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1094820..1095902
Genome map
AA seq 360 aa AA seqDB search
MSDKKIKVLCVDDSALIRSLMTEIINSQADMTVVATAPDPLVARDLIKQLNPDVLTLDVE
MPRMDGLDFLEKLMRLRPMPVLMVSSLTERGSEITLRALELGAVDFVTKPRLGIREGLLE
YTDLIADKIRAAARARLQSVRRSDADAAAAAGLTPMLRSPLLSTEKLIIIGASTGGTEAI
REVLQPLPPDCPGIMIAQHMPPGFTRSFAQRLDGLCRITVKEAEHGERVLPGHAYIAPGG
FHLSLARSGANYVAHLDQEDPVNRHRPSIDVLFDSVAQHAGKNAIGVILTGMGRDGAAGL
LRMRQAGAYTLAQDEASCVVFGMPREAIAMGAASEVAGIAEMSTRLMARLMSYGERSNRV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataaaaaaatcaaggtattgtgtgtcgacgattcagcgctgatacgcagcctg
atgacggaaatcatcaatagccaggcggatatgacggtggtggcgacagcgcccgatccg
ctggtggcgcgcgacctgatcaagcagctcaatccggacgtgctgacgctggacgtcgaa
atgccgcgcatggacggcctggatttcctggaaaaactgatgcgcctgcggccgatgccg
gtgctgatggtgtcctcgctgaccgaacgcggatccgaaatcacgctgcgggcgctggaa
ctgggggcggtcgattttgtcaccaagccgcgcctcggcatacgcgaaggcctgctggaa
tataccgacctgatcgccgacaagatccgtgcggcggcccgcgcccgcctgcagtcagtg
cgccgctccgacgccgatgcggcggcagcggccggattgacgccgatgctgcgcagccct
ttgctgagtaccgagaagctgatcatcatcggcgcttccaccggcggcaccgaagcgatc
cgggaagtcttgcagccgctgccgccggattgcccgggcatcatgatcgcgcaacacatg
ccacccgggtttacccgctcctttgcgcagcgcctggacggcctgtgccgcatcaccgtc
aaggaagcggagcacggcgagcgggtgttgccgggccacgcttatatcgcacccggcggc
ttccatctgtcgctggcgcgcagcggcgccaattatgtcgcgcatctggaccaggaagat
ccggtaaaccgccatcggccatcgatcgatgtgttgttcgattcggtcgcccagcatgcc
ggcaagaacgccatcggcgtgatcctgaccggcatggggcgggatggcgcagccggcttg
ctgcgcatgcgccaggccggcgcctataccctggcgcaagacgaagccagctgcgtggtg
ttcggcatgccgcgtgaagccatcgccatgggtgcggccagcgaagtggccggtatagcc
gaaatgagcacccgtctgatggcgcgcctgatgtcgtacggcgaacgctcaaaccgggtg
tga

DBGET integrated database retrieval system