KEGG   Collimonas fungivorans: CFU_1082Help
Entry
CFU_1082          CDS       T01583                                 

Gene name
jamB2
Definition
delta-9 fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cfu  Collimonas fungivorans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cfu01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cfu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1263941..1264909)
Genome map
AA seq 322 aa AA seqDB search
MTTQTNVLPPKPASAAGPALRPGVAPLTGAGATIKQITALVVMLVPLAGFALALQRALEG
RMSTTDLVLFGVFYFLHMGGITMGFHRYLAHKTFNTSPFFEGLLLICGSMAAQGPIMFWV
TTHRRHHTYSDQHGDPHSPNLHGPGLLGRLRGIWYAHMPWMLAKDVSGWNFFAPDILANR
KLFFYHRTYGLWIVLGLALPAAIGGAVGGSWDAAFSGFLFGGLARIFLANQAAWCVGSVC
HMIGGKPFKTDDNSANNWTVAILTFGEGLQNNHHAFPGSYRHGVKWWEPDLSGWLLAGFG
KIGVVWNLRSPDEKAVAKMRAR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgactacgcaaaccaatgtcttacctcccaaaccggcgagcgccgccggtcctgcactg
aggccgggcgtcgcaccgctgaccggcgccggcgccaccatcaagcagattaccgcgctg
gtggtcatgctggtgccgctggcgggattcgcgctggcgctgcagcgtgcgctggaagga
cgcatgtcgaccaccgacctggtgctgttcggcgttttctatttcctccacatgggcggc
atcacgatgggtttccatcgctacctggcgcacaagaccttcaacacctcgccgttcttc
gagggcttgctgctgatctgcggttcgatggcggcgcaagggccgatcatgttctgggtc
accacccatcgccgccaccacacctacagcgaccagcacggcgatccgcattcgcccaac
ctgcacggaccgggcctgctgggccgcctgcgcggcatctggtatgcgcacatgccgtgg
atgctggccaaggacgtctccggctggaatttctttgcgccggacatcctcgccaaccgc
aagctgttcttttaccaccgcacctacggtctgtggatcgtgctcggtctggccctgcca
gctgccatcggcggcgcggtcggcggcagctgggacgcggctttcagcggttttctgttc
ggcgggctggcgcggattttcctggccaaccaggctgcctggtgcgtcggttcggtgtgc
cacatgattggcggcaaaccgttcaagaccgacgataacagcgccaacaactggactgtc
gccatcctcactttcggcgaaggcttgcagaataaccaccatgcgttcccaggctcgtac
cgccacggcgtcaaatggtgggagcccgacctgagcggctggctgctggccggtttcggc
aagatcggcgtggtctggaacctgcgctcgcctgacgaaaaagccgtcgccaagatgcgc
gcccgctaa

DBGET integrated database retrieval system