KEGG   Collimonas fungivorans: CFU_1211Help
Entry
CFU_1211          CDS       T01583                                 

Gene name
fadB2
Definition
3-hydroxybutyryl-CoA epimerase (EC:5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cfu  Collimonas fungivorans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cfu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CFU_1211 (fadB2)
   01212 Fatty acid metabolism
    CFU_1211 (fadB2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CFU_1211 (fadB2)
   00650 Butanoate metabolism
    CFU_1211 (fadB2)
  Lipid metabolism
   00071 Fatty acid degradation
    CFU_1211 (fadB2)
   01040 Biosynthesis of unsaturated fatty acids
    CFU_1211 (fadB2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFU_1211 (fadB2)
   00310 Lysine degradation
    CFU_1211 (fadB2)
   00380 Tryptophan metabolism
    CFU_1211 (fadB2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CFU_1211 (fadB2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CFU_1211 (fadB2)
   00281 Geraniol degradation
    CFU_1211 (fadB2)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    CFU_1211 (fadB2)
Enzymes [BR:cfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CFU_1211 (fadB2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CFU_1211 (fadB2)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CFU_1211 (fadB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1421266..1423398)
Genome map
AA seq 710 aa AA seqDB search
MSVNFQKDGDNIVTLTLDMPGRSMNVLNEALTAPFMEAIAAIEADPAIAGVIITSGKADF
VAGADIEKLFQITEAQTAFDLVQQFKGFLRRLELCGRPVVAALNGTALGGGLELALACHH
RIAINNPKAKFGLPEVKLGLLPGGGGTQRLPRMIGIQGALQLMLEGKELRAEEALQQGII
QELASDREDLLAKAKAWCLANPKAKQPWDDKKFRWPGGDSRSPGNGQLWAIAPSMASAKT
HGNYPAATNIMSCVFEGGIVDFDTGCEIESRYFVNCALSPVAKNMIGTLWFQLNAINKGK
SRPEGIAPSKVSKVGILGAGMMGAGIAYASAKAGIQVVLLDNSLETAENGKDYSSKLLDK
AIKRKQQTAEGKQALLDRIRPTVDFGDLASCDLIIEAVFEDREVKATVTRKTEALISADA
VFASNTSTLPITGLAQASVRPENFIGLHFFSPVDKMPLVEIIVGRQTSQQTLARGFDYVQ
QIKKTPIVVHDSRGFYTSRVFGTYVMEGLKLLMEGQHPRAIEMAGLQAGMPVGPLAVHDE
VSLSLSLHILQQTRKDFAEAGKPFAGHPADAGLEKMVTQLDRKGKKAGKGFYDYPENESK
HLWPGLQQAFPLAATQLPQKDLIERLMFVQANEAAKCYEEQVVLTVADANIGSIFGWGFA
PFQGGALQYINAYGVANFVRRANQLSEQFGSYFAPAAILVKMAEQGKHFE
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtaaattttcaaaaagacggcgacaatatcgtgaccctgaccctggacatgcca
ggacggtcgatgaatgtattgaacgaagcgctgaccgcgccgttcatggaggcgatcgcc
gccatcgaagccgacccggctatcgccggcgtcatcattacctcaggcaaggcggatttc
gtggccggcgccgatatcgaaaaactgttccagattactgaggcgcaaacagccttcgac
ctggtgcagcaattcaaaggtttcctgcgccgcctcgaactatgcggccggccggtggtg
gccgcgctgaacggcaccgcgctgggcggcggcctggagctggcgctggcctgccatcac
cgcatcgccatcaacaatccgaaagccaagttcggcctgccggaagtcaagctcggcctg
ctgccgggcggcggcggcacacaacgcctgccgcgcatgatcggcatccagggcgcgctg
cagctgatgttggaaggcaaggagctgcgcgccgaagaagcgctgcagcaaggcatcatc
caggaactggcgagcgacagggaagacttgctggccaaggccaaagcctggtgcctggcc
aatcccaaggccaagcagccgtgggacgacaagaaattccgctggcccggcggcgactcg
cgcagcccgggcaacggccagctgtgggcgattgcgccgtccatggcaagcgccaagacc
catggcaattatcctgcggcgaccaacatcatgagctgcgtattcgaaggcggcatcgtc
gatttcgataccggctgcgaaatcgaatcgcgctacttcgtcaactgcgccttgtcgccg
gtcgccaagaacatgatcggcaccttgtggttccagctgaacgccatcaacaagggcaag
tcgcgcccggaaggcatcgcgccatccaaggtcagcaaggtaggcatactcggcgccggc
atgatgggcgccggcatcgcctatgcctcggccaaggccggcatacaagtggtgttgctg
gacaacagcctggaaaccgccgaaaacggcaaggactattccagcaagctgctcgacaag
gcgatcaagcgcaagcagcaaaccgcggaaggcaagcaagccctgctggatcgcatcagg
ccgaccgtggatttcggcgacctggcaagctgcgacctgattatcgaggcggtgtttgaa
gaccgcgaggtcaaggcaacagtgacccgcaaaaccgaagcgctgatcagcgccgacgca
gtgtttgcctcgaacacctctaccctgccgatcaccggcctggcgcaggccagcgtacgg
ccggaaaatttcatcggcctgcatttcttctcgccggtggacaagatgccgctggtcgaa
atcatcgtcggccggcagaccagccagcaaaccctggcgcgcggtttcgactacgtgcag
cagatcaagaaaacaccgatcgtagtccacgattcacgcggcttctacacctcgcgcgta
ttcggcacctatgtgatggaaggcttgaaattgctgatggaaggccagcatccgcgcgcc
atcgagatggcgggcttgcaggccggcatgccggtggggccgctggcagtgcacgatgaa
gtcagcctgtccttgtcgctgcatatcctgcaacagacgcgcaaggatttcgccgaagcc
ggcaaacctttcgccggccatccggccgatgccgggctggaaaaaatggtgacccagctc
gaccgcaaaggcaaaaaagccggcaagggattttatgattatccagaaaacgaaagcaag
cacctgtggcccggcctgcagcaggccttcccgctcgcagccacgcagctgccgcaaaag
gacttgatcgaacgtttgatgtttgtgcaggccaacgaagccgcaaagtgttatgaggaa
caggtagtgctgaccgtcgccgacgccaatatcggcagcattttcggctggggattcgca
ccgttccagggcggcgccctgcaatacatcaacgcctacggcgtcgctaattttgtccgg
cgcgcgaaccagctatcagagcagttcggcagttatttcgcaccggccgcgatactggtg
aaaatggcggaacaaggcaaacacttcgaatag

DBGET integrated database retrieval system