KEGG   Collimonas fungivorans: CFU_1226Help
Entry
CFU_1226          CDS       T01583                                 

Definition
putative Guanyl-specific ribonuclease St (RNase St) (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
cfu  Collimonas fungivorans
Brite
Enzymes [BR:cfu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     CFU_1226
Transfer RNA biogenesis [BR:cfu03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    CFU_1226
 Prokaryotic Type
    CFU_1226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1437602..1438036
Genome map
AA seq 144 aa AA seqDB search
MKSHATRRHFPGLSSDFAAAIAVAVLRNGALLLLGLLLSFQVFARDSLSQDVVSIGQLPQ
EAQATLVLIKQGGPFPYAKDGVVFGNYEGMLPRQRRGYYHEFTVKTPRARNRGARRIIAG
GNPQTSGEYYYTDDHYQTFRRIQE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagccacgcaacccggcgccatttccctggtctaagttccgatttcgcggctgcc
atcgctgttgcagtattacgcaacggggccttgctgctgctcggtttgttgttgtctttt
caagtatttgcgcgggactccctgtcgcaagatgtggtttccataggtcagttgccgcag
gaagcgcaagcgacgctggtcttgatcaagcaaggcggacctttcccgtatgccaaggat
ggcgtggtgttcgggaattatgaagggatgctgcccaggcagcggcgcgggtattaccac
gaattcacggtgaaaactccgcgcgcgcgcaaccgcggcgcacgccggatcatcgccggc
ggcaatccgcagacttcgggcgagtattactacactgacgatcactatcaaacattcagg
cgcatccaggagtga

DBGET integrated database retrieval system